KEGG   Myxococcus xanthus: MXAN_6306Help
Entry
MXAN_6306         CDS       T00366                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mxa  Myxococcus xanthus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MXAN_6306
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MXAN_6306
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MXAN_6306
Lipid biosynthesis proteins [BR:mxa01004]
 Desaturase
  First
   MXAN_6306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7783648..7784712
Genome map
AA seq 354 aa AA seqDB search
MQTPSPALPAADERLNWLSSIPFFAVHLMCLFVFAVGAKPVDVAVCVGLYVVRMWGITAG
FHRYFSHRAFKTGRVFQFILAFVGSMSAQKGVLWWAAHHRHHHRYSDQAEDIHSPLQKGF
WWSHAGWILSDKYNDTRMEGIKDFARFPELVWLNRFHLVPSVLLAVALYFIGGFSMLVWG
FFVSTTLLWHGTFTINSLSHIFGKRRYKTTDTSRNNWLLALLTLGEGWHNNHHFHQNTAN
QGWFWWEVDLSYYSLKVLSWFKVVEGLRLPSEATKFAFQKYTDEERAALAAPTRFWGASG
ARAQFVATKAAGDAARAASDAAKAAGDKVREALTTAADHLPTSAPPPSAMLKRR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
ttgcagacaccgtctccagccctgcccgcggcggatgagcgcctcaactggctctcctcc
atccccttcttcgcagtccacctgatgtgcctgttcgtcttcgccgtcggcgcgaagccg
gtggacgtggccgtgtgcgtcggcctctacgtcgtgcgcatgtggggcatcaccgcgggc
ttccaccggtacttctcccaccgggccttcaagacgggacgcgtcttccagttcatcctc
gccttcgtgggcagcatgtccgcgcagaagggcgtgctgtggtgggcggcgcaccaccgc
caccaccaccgctattcggaccaggcggaggacatccactcgcccctgcagaagggcttc
tggtggagccacgcggggtggattctctccgacaagtacaacgacacccgcatggagggc
atcaaggacttcgcccgcttcccggagctggtgtggctcaaccgcttccacctggtgccg
tccgtcctgctggccgtggcgctctacttcatcggaggcttctccatgctggtgtggggc
ttcttcgtcagcaccaccctgctgtggcacggcaccttcaccatcaactcgctcagccac
atcttcggcaagcgccgctacaagacgacggacaccagccggaacaactggctgctggcg
ctcctcaccctgggcgaggggtggcacaacaaccaccacttccatcagaacaccgccaac
cagggctggttctggtgggaggtggacctcagctactactcgctgaaggtgctctcctgg
ttcaaggtggtggaggggctgcggcttccctccgaggccacgaagttcgcgttccagaag
tacaccgacgaagagcgcgcggcgctggcggcccctacccgcttctggggtgcttcgggc
gcgcgggcccagttcgtggccacgaaggccgcgggggatgcggcccgggccgccagtgat
gcggcgaaggccgcgggcgacaaggtgcgagaggccctgacgaccgccgcggaccacctg
cccacctccgcgccgccaccctccgccatgctcaagcggcgatag

DBGET integrated database retrieval system