KEGG   Myxococcus xanthus: MXAN_6373Help
Entry
MXAN_6373         CDS       T00366                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase I
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00010  Glycolysis / Gluconeogenesis
mxa00030  Pentose phosphate pathway
mxa00051  Fructose and mannose metabolism
mxa00052  Galactose metabolism
mxa00680  Methane metabolism
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_6373 (pfkA)
   00030 Pentose phosphate pathway
    MXAN_6373 (pfkA)
   00051 Fructose and mannose metabolism
    MXAN_6373 (pfkA)
   00052 Galactose metabolism
    MXAN_6373 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MXAN_6373 (pfkA)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MXAN_6373 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     MXAN_6373 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK HHH_6 UPF0261 NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABF87778
UniProt: Q1CYM6
Position
7852969..7854006
Genome map
AA seq 345 aa AA seqDB search
MKVAVLTGGGDCPGLNAVIRAVVRRANAHGFEMMGLRDGWKGLLEDNHFRLTRETTSGIL
HRGGTILGTSRVNPFKVENGLERVKRAIERNGIHAVIAIGGEGTLSAATRMSQEGLRIVG
VPKTIDNDINATDFTFGFDTAVAIATEAIDRLHSTAESHKRVIVCEVMGRHVGWIATYAG
IAGGADVILVPEIPADLAKVAEHIQRRHAGGRTFSIVVVAEGTRIKLSADQQEQLVTSGA
LDEAGRPRLGGVGTILAHEIERRTGFETRVSVLGHIQRGGAPTAHDRVLATRYGVHACDM
VARGEFGKMAALRGNDIISVDLADATRELKRVPQEFFEVAQVFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccgtgctcaccggcgggggtgactgccccggcctgaacgccgtcatccgc
gccgtcgtccgccgcgccaacgcccacggcttcgagatgatgggcctccgagatggttgg
aaggggttgttggaggacaaccacttccgcctcacgcgtgaaaccacgtccggaatcctc
caccggggcggaaccatcctcggcacctcgcgcgtcaacccgttcaaggtcgaaaacggg
ctggagcgcgtcaagcgcgccatcgaacgcaacggcatccacgccgtcatcgccattggt
ggcgaaggcacgctgtcggccgccacgcgcatgtcgcaggaaggactgcgcatcgtcggt
gtgccgaagaccatcgacaacgacatcaacgccacggacttcaccttcggcttcgacacg
gccgtcgccatcgccaccgaggccattgaccggctgcactccaccgcggagtcgcacaag
cgcgtcatcgtctgcgaggtgatgggccgtcacgtgggctggattgccacctacgcgggc
atcgctggcggcgcggacgtcatcctggtgccggagattcccgccgacctcgcgaaggtg
gccgagcacatccagcgccgccacgcgggcgggcgcaccttctccattgtcgtggtggcg
gagggtacgcgcatcaagctgtcggcggaccagcaggagcagctcgtcaccagcggcgca
ctggacgaggcaggcaggccgcggctcggtggcgtgggcaccatcctggcgcacgaaatc
gagcggcgcaccggcttcgagacgcgcgtgtccgtgctgggccacatccaacgcggcggc
gcccccaccgcgcatgaccgcgtgctcgccacccgctacggcgtccacgcctgcgacatg
gtggcccgcggcgagttcgggaagatggccgcgctgcgaggcaacgacatcatcagcgtg
gacctggcggacgccacccgcgagctcaagcgcgtcccgcaggagttcttcgaagtcgcc
caggtcttcttcggctga

DBGET integrated database retrieval system