KEGG   Myxococcus xanthus: MXAN_6373Help
Entry
MXAN_6373         CDS       T00366                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mxa  Myxococcus xanthus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_6373 (pfkA)
   01230 Biosynthesis of amino acids
    MXAN_6373 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_6373 (pfkA)
   00030 Pentose phosphate pathway
    MXAN_6373 (pfkA)
   00051 Fructose and mannose metabolism
    MXAN_6373 (pfkA)
   00052 Galactose metabolism
    MXAN_6373 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    MXAN_6373 (pfkA)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MXAN_6373 (pfkA)
Protein phosphatases and associated proteins [BR:mxa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MXAN_6373 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7852969..7854006
Genome map
AA seq 345 aa AA seqDB search
MKVAVLTGGGDCPGLNAVIRAVVRRANAHGFEMMGLRDGWKGLLEDNHFRLTRETTSGIL
HRGGTILGTSRVNPFKVENGLERVKRAIERNGIHAVIAIGGEGTLSAATRMSQEGLRIVG
VPKTIDNDINATDFTFGFDTAVAIATEAIDRLHSTAESHKRVIVCEVMGRHVGWIATYAG
IAGGADVILVPEIPADLAKVAEHIQRRHAGGRTFSIVVVAEGTRIKLSADQQEQLVTSGA
LDEAGRPRLGGVGTILAHEIERRTGFETRVSVLGHIQRGGAPTAHDRVLATRYGVHACDM
VARGEFGKMAALRGNDIISVDLADATRELKRVPQEFFEVAQVFFG
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccgtgctcaccggcgggggtgactgccccggcctgaacgccgtcatccgc
gccgtcgtccgccgcgccaacgcccacggcttcgagatgatgggcctccgagatggttgg
aaggggttgttggaggacaaccacttccgcctcacgcgtgaaaccacgtccggaatcctc
caccggggcggaaccatcctcggcacctcgcgcgtcaacccgttcaaggtcgaaaacggg
ctggagcgcgtcaagcgcgccatcgaacgcaacggcatccacgccgtcatcgccattggt
ggcgaaggcacgctgtcggccgccacgcgcatgtcgcaggaaggactgcgcatcgtcggt
gtgccgaagaccatcgacaacgacatcaacgccacggacttcaccttcggcttcgacacg
gccgtcgccatcgccaccgaggccattgaccggctgcactccaccgcggagtcgcacaag
cgcgtcatcgtctgcgaggtgatgggccgtcacgtgggctggattgccacctacgcgggc
atcgctggcggcgcggacgtcatcctggtgccggagattcccgccgacctcgcgaaggtg
gccgagcacatccagcgccgccacgcgggcgggcgcaccttctccattgtcgtggtggcg
gagggtacgcgcatcaagctgtcggcggaccagcaggagcagctcgtcaccagcggcgca
ctggacgaggcaggcaggccgcggctcggtggcgtgggcaccatcctggcgcacgaaatc
gagcggcgcaccggcttcgagacgcgcgtgtccgtgctgggccacatccaacgcggcggc
gcccccaccgcgcatgaccgcgtgctcgccacccgctacggcgtccacgcctgcgacatg
gtggcccgcggcgagttcgggaagatggccgcgctgcgaggcaacgacatcatcagcgtg
gacctggcggacgccacccgcgagctcaagcgcgtcccgcaggagttcttcgaagtcgcc
caggtcttcttcggctga

DBGET integrated database retrieval system