KEGG   Myxococcus xanthus: MXAN_6411Help
Entry
MXAN_6411         CDS       T00366                                 

Definition
protein-arginine deiminase
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
mxa  Myxococcus xanthus
Brite
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     MXAN_6411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7895877..7897790
Genome map
AA seq 637 aa AA seqDB search
MSFHRDWGCPSAPPENAMPPSPHARARLLPLLLACLLASACGPVADDEGGRPGSEDPLEG
PFHPVVDLRADVNRNGIVELDNPAEDEDEDTWTAERGAIFLANLDDDEHACPFSMDPHRI
SDDALAQCHDAMDAVVNGESDLEDLARLRTVPWPEAPAGTVGSVIVSGAAGKKVRLFKRV
RGNFISGGFPDTVFLSTAEIRRGVVLAIEGRDIVRDPEEWDGFADVVLTIGRNNPHDPVF
TDTVRMRVAPVVLFHHMTPAWNVFVSKPAASIEANQFRQALGGVLADSGERMVYSEFAVD
DLWAQDYFEPAYMSMPAPEGRQHVMKVNYRAPHVYNTDANAPLRAAGRIAFWLRGPDTAA
IQQYQQGMSMASQTLNSFGNTEVIPPYEKDGVTYPLGRLFRGRGPDSRPDYQPDPSFTQM
LEAQAVQPPIYVDTSWLFVDHVDETFTFLPAPTPRGWIALVADPALARRILQDAQARGHG
DAKLFAGLSWAYSIPAEASIAEVLDNPGLMDASAVAALEIDTQLSILREETGLTDADIIR
VPFLFQNASDGVTAYQPATLNLLSLTPTQVIAPDPHGPLLDGEDPFKTRFEEALGAHGIH
VHWVDAWAPFHIAQGQVHCATQSARQVPDVKWWEGGR
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttccaccgggattggggctgcccgtcggcgcccccggagaacgccatgccgccg
tccccgcatgcccgagcacgtctcctgccgctgttgctggcatgcctgttggccagcgcc
tgcgggcccgtggccgatgacgaagggggacgccccggaagcgaggatccactcgagggg
cccttccatccggtggtcgacctgcgcgcggatgtgaatcgcaatggcatcgtcgagctc
gacaaccccgcggaggacgaggacgaggacacctggacggcggagcgcggcgccatcttc
ctggccaacctggacgacgacgagcacgcctgccccttctccatggacccccatcgcatc
agcgacgacgcgctggcgcagtgccatgacgccatggacgcggtggtgaatggcgagtcg
gacctagaggacctggcccggctgcgcacggtgccctggcccgaggcgcccgcgggcacg
gtgggctccgtcatcgtgtccggggccgctggcaagaaggtgcgcctgttcaagcgcgtg
cggggcaacttcatctcgggcggatttcccgacacggtgttcctgtcgaccgctgagata
cggcgcggcgtggtgctcgccatcgaggggcgcgacatcgttcgcgaccccgaggaatgg
gatggcttcgcggacgtggtgctcaccatcggccgaaacaatccgcacgacccggtgttc
accgacaccgtccgcatgcgcgtggcgcccgtggtgctcttccaccacatgacgcccgcc
tggaacgtcttcgtctccaagcccgccgccagcatcgaagccaaccagttccggcaggcg
ctgggcggcgtgctcgcggactcaggagagcggatggtctactccgagttcgcggtggat
gatttgtgggcgcaggactacttcgagcccgcgtacatgtcgatgcctgcgccggagggc
cgccagcacgtcatgaaggtcaactaccgcgcgccgcacgtctacaacaccgacgcgaac
gcgcccctgcgcgcggccggccgcatcgcgttctggcttcgcggccccgacactgccgcc
atccagcagtaccagcagggcatgtccatggcctcccagacgctgaactccttcggcaat
acggaggtcatcccgccttacgagaaggacggtgtcacgtatcccctgggccggctgttc
cggggccgggggccggactcgcggccggactatcagcccgaccccagcttcacgcagatg
ctggaggcgcaggccgtgcagcctcccatctacgtggacacctcgtggctgttcgtggac
cacgtggatgagacgttcaccttcctgcccgcccccacgcctcggggctggattgccctg
gtggccgacccggcgctcgcgcggcggatactccaggacgcgcaggcccgggggcacgga
gacgcgaagctcttcgccggcctgtcctgggcgtactccatacccgcggaggcgagcatc
gccgaggtgctcgacaaccccggactgatggacgccagcgccgtggcggcactggaaatc
gacacgcaactctccatcctccgcgaggagacgggcctcacggacgctgacatcatccgc
gtgcccttcctcttccagaacgcgtcagacggcgtgacggcgtaccagcccgccacgctg
aacctgctgtcgttgacgcccacgcaggtcatcgcgccagacccgcatggaccgctcctc
gatggggaggacccgttcaagacgcggttcgaggaggcgctcggggcccatggcatccac
gtgcactgggtggatgcgtgggcgccgttccacatcgcccagggccaggtccactgcgcc
acccagagcgctcggcaggtgcccgacgtgaagtggtgggagggtggacgatga

DBGET integrated database retrieval system