KEGG   Myxococcus xanthus: MXAN_6441Help
Entry
MXAN_6441         CDS       T00366                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
mxa  Myxococcus xanthus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MXAN_6441 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MXAN_6441 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    MXAN_6441 (aceB)
Enzymes [BR:mxa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MXAN_6441 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7944010..7945635
Genome map
AA seq 541 aa AA seqDB search
MSDQAPSVKPPAFGPGVVVKGTWHPDYAEVLTPEALEFVAKLARNFGERRLALLERRKTV
QAAWSKGARPHFLPETKAVREGDWTVAPLPADLQDRRVEITGPVDRKMVINALNSGANVF
MADFEDANSPTWDNVVRGQINLRDAVRGTISFTAENGKHYALNPKRAVLFVRPRGWHLPE
RHIEIDGKPISGSLLDFGLFFFHNAREQLARGTGPYFYLPKMQSHLEARLWNDVFHLAQA
ELGIPRGTIKATVLIETLPAAFEMDEILYELREHSAGLNCGRWDYIFSFIKTLQSDTRVV
LPDRGQVTMDKAFLNAYSQLLIQTCHRRNVHAMGGMAAFIPIKGDAAANDAVMDKVRADK
LREVKNGHDGTWVAHPGLVEIARDIFDSHMKGPNQLSNKREDVKIGEAELLKVPSGTRTE
EGLRHNIRVGIQYTAAWLGGLGCVPLYNLMEDAATAEISRAQVWQWIHHGASLEDGRKVT
LTLFRDALGEEMGRLEKEGAKERYGAAHLERARVLFEQLSTAGTFEDFLTLPAYDALEAQ
R
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaccaagccccctctgtgaaacccccggcgttcggaccgggagtggtggtgaag
gggacctggcaccccgactacgccgaggtcctcacgcccgaggccctggaattcgtggcg
aagctggcccgcaacttcggcgagcgccggctggccctgctggagcgccgcaagacggtg
caggcggcctggagcaagggagcgcggccccacttcctgccggagacgaaggccgtccgg
gagggcgactggacggtggctcccctgcccgccgaccttcaggaccgccgcgtggagatc
accggcccggtggaccggaagatggtcatcaacgcgctgaactccggggcgaatgtcttc
atggcggacttcgaggacgccaacagccccacctgggacaacgtggtgcgcgggcaaatc
aacctgcgcgacgccgtgcgcggcaccatctccttcacggcggagaacgggaagcactac
gccctcaacccgaagcgcgccgtgctcttcgtgcgcccccgcggctggcacctgccggag
cggcacatcgaaatcgacggcaagcccatctccggctcgctgctcgatttcgggctcttc
ttcttccacaacgcccgtgagcaactggcccgcggcaccggcccctacttctacctgccg
aagatgcagagccacctggaggcccggctgtggaacgacgtgttccacctggcccaagcg
gagctgggcatcccgcgcggcaccatcaaggccactgtcctcatcgagacgctgcccgcc
gcgttcgagatggacgaaatcctctacgagctgcgcgagcactccgccggcctcaactgc
ggccgctgggactacatcttcagcttcatcaagacgctccagtcggacacccgcgtggtg
ctgcccgaccgcggccaggtgacgatggacaaggcgttcctcaacgcctactcgcaactg
ctcatccagacctgccaccgccgcaacgtgcacgccatgggcggcatggcggccttcatc
cccatcaagggggacgcggcggccaacgacgccgtcatggacaaggtccgcgcggacaag
ctgcgcgaggtgaagaacggccacgacgggacgtgggtggcgcaccccggcctcgttgaa
atcgcgcgcgacatcttcgactcgcacatgaagggccccaaccagctctccaacaagcgc
gaggacgtgaagattggcgaggcggagctgctcaaggtgccgtccggcacgcgcaccgag
gaaggcctgcgccacaacatccgcgtgggcatccagtacaccgccgcgtggctgggcggc
ctgggctgcgtgccgctctacaacctgatggaggacgcggccaccgccgaaatctcacgc
gcccaggtatggcagtggatccaccacggcgcctccctggaggacggccgcaaggtgacg
ctcaccctcttccgcgacgcgctgggcgaggagatgggccgcctcgagaaggaaggcgcc
aaggagcgctacggcgccgcccacctggagcgcgcacgcgtcctcttcgagcagctctcc
accgccggcaccttcgaggacttcctcaccctgccggcctacgacgccttggaagcccaa
cgctga

DBGET integrated database retrieval system