KEGG   Myxococcus xanthus: MXAN_6463Help
Entry
MXAN_6463         CDS       T00366                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mxa  Myxococcus xanthus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MXAN_6463 (malQ)
Enzymes [BR:mxa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     MXAN_6463 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
7966698..7968248
Genome map
AA seq 516 aa AA seqDB search
MSTPGRLSGLLLPLFSLRSQTDFGIGDFGALEGLFTWMKSARQRMLMVLPLLPTAPGDSS
PYATRSAFGLNPLFIDLQRLPEFTAAGGEAALSDAQRAQLAEARSAPRVRYDLVFPLKDT
AFARAFDVFEAQHWAPQSERAKTFRQWRDAQGEWLESYALFTAISEQEERRPWWEWPEPL
RTRQPEALAQKSRELERRVRYHAWLQWVAEQQWNEVRTQARAKDVLLCGDEPFIIGQDSA
DVWAHPDILRRDARLGVPPDDFSATGQDWGLPYFDLAAMEKDDFAWLKTRAKKAASYYDL
RRVDHAVGYFRQWIRDAQTPTGRFIPPDEESHRRLGEKTFRLLSEGAGIVAEDLGVIPHF
VRHILAELKLPGYRVMRWERDDNHYRDPRQFPAVSLVTTGTHDTDTMAEWWEGAGDHERQ
AAARSWPELNGVAITREFTPDVHRAMLASALNANSDLCVLPWQDVLGTRDRINLPGSMSD
SNWAYRIEQNVSDLLTDSRTREAAERLAWLTASARR
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccccggccggctctccggtcttttgctcccgcttttctccctccgctcacag
accgactttggcatcggtgacttcggtgccctggagggactgttcacctggatgaagtcc
gcccgccagcggatgctgatggtgctgccgctgctgcccaccgcgccgggcgactcgagc
ccctacgcgacgcgttcggccttcggcctcaatcccctcttcatcgacctgcagcggctg
ccggagttcaccgcggccggcggcgaggcggccctgtccgacgcgcagcgcgcccagttg
gccgaggcgcgctctgcgccgcgcgtgcgctatgacctggtcttccccctcaaggacacc
gccttcgcgcgcgccttcgacgtcttcgaagcgcagcactgggcgccccagtccgagcgg
gcgaagaccttccgccagtggcgcgacgcccagggcgaatggctggagagctacgcgctc
ttcaccgccatcagcgagcaggaagagcgccgcccgtggtgggagtggccggagccgctg
cgcacccgtcaacccgaggccctggcccagaagtcccgggagctggagcgccgcgtgcgc
taccacgcctggctccagtgggtggccgagcagcagtggaacgaggtgcggacgcaggcc
cgcgccaaggacgtcctcctgtgcggcgacgagccgttcatcatcggtcaggacagcgcg
gacgtgtgggcgcacccggacatcctgcggcgcgacgcccgcctgggcgtgcctccggat
gacttctccgccacgggccaggactggggcctgccctacttcgacctggcggccatggag
aaggacgacttcgcgtggctgaagacgcgcgcgaagaaggcggccagctactacgacttg
cgccgcgtggaccacgcggtggggtacttccggcagtggattcgcgacgcgcagacgccc
accgggcgcttcatcccgccggacgaggagagccaccgccgcctgggcgagaagaccttc
cgcctgctgtccgagggcgccggcatcgtcgccgaggacctgggcgtgattccacacttc
gtgcgccacatcctcgcggagctcaagctgcccggctaccgggtgatgcgctgggagcgc
gacgacaaccactaccgcgacccgcgccagttcccggcggtgtccctggtcaccaccggc
acgcatgacacggacacgatggccgagtggtgggagggcgcgggcgaccacgagcggcag
gcggcggcgcgctcatggccggagctcaacggcgtggccatcacccgcgagttcaccccg
gacgtgcaccgggccatgctggcctcggcgctcaacgccaacagcgacctgtgcgtgttg
ccctggcaggacgtgctcggcacccgggaccgcatcaacctgcccggctccatgagcgat
tcgaactgggcctaccgcatcgaacagaacgtgagtgacctgctcaccgattcgcgcacg
cgcgaggccgccgagcggctggcctggctcaccgcgtccgcgcggcgctga

DBGET integrated database retrieval system