KEGG   Myxococcus xanthus: MXAN_6497Help
Entry
MXAN_6497         CDS       T00366                                 

Gene name
glcK
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00010  Glycolysis / Gluconeogenesis
mxa00052  Galactose metabolism
mxa00500  Starch and sucrose metabolism
mxa00520  Amino sugar and nucleotide sugar metabolism
mxa00521  Streptomycin biosynthesis
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
Module
mxa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mxa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MXAN_6497 (glcK)
   00052 Galactose metabolism
    MXAN_6497 (glcK)
   00500 Starch and sucrose metabolism
    MXAN_6497 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    MXAN_6497 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MXAN_6497 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MXAN_6497 (glcK)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MXAN_6497 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG Hexokinase_2 FGGY_N Hydant_A_N TruB-C_2
Motif
Other DBs
NCBI-ProteinID: ABF91964
UniProt: Q1CYA3
Position
complement(8010323..8011255)
Genome map
AA seq 310 aa AA seqDB search
MPTLGIDLGGTFARAAVVDEVGKLIASSKVALVERSPSGVVETIAQAASDAVMAAGVPLG
ACGVAAAGQIHKDSGVLSVAPNLGWRNVPLGALLTDRLGQPVRVVNDLAAAAWGELHAGA
GRGSQDMLVVFVGSGVGSAIIAGGRLVDGGGGVAGELGHIKVVPGGRRCGCGELGCLEAY
AGGHNLIAQTRELLASGGAPEVARLTGGDPARITPVTLEQAAEAGDVAAGEVYARAAQFL
ALAVANQVTMLNPARLVLGGGVLRHCPGLRRRVEEGVRAWSSTTSREGLLIADAELGDDS
GLIGAALLVK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgctcggaatcgacctgggggggaccttcgcccgcgccgccgtggtggacgag
gttggcaaactgatcgcctcctcgaaggtggctttggtggagcgcagtccctcgggggtc
gtggagaccattgcccaggcggcctcggacgcggtgatggccgccggtgtgccgctgggc
gcgtgcggtgtggcggccgccgggcagattcacaaggactcgggcgtgctgtcggtggct
cccaatctgggctggcgcaacgtgccgctgggcgcgctgctcacggaccggctgggccag
ccggtgcgcgtggtgaatgacctggccgcggcggcctggggcgaactccacgccggcgcg
ggtcggggctcccaggacatgctggtggtgttcgtgggctcgggtgtggggagcgccatc
atcgcgggcggacggctcgtagatggcggtggcggtgtggcgggcgagttgggccacatc
aaggtggttcccggcgggcgccgctgcggctgtggtgagctggggtgtctggaggcctac
gccggtggccacaacctcatcgcgcagacgcgggagttgctcgccagcggtggtgcgccg
gaggtggcgcggctgacgggcggagacccggcgcgcatcaccccggtgacgttggagcag
gcggcggaggcgggcgacgtggcggccggtgaagtctacgcgcgggcggcgcagttcctg
gccctggccgtggccaaccaggtgacgatgctcaacccggcgcggctggtgctgggtggc
ggcgtgctgagacactgcccgggcctgcggcgccgtgtggaggagggcgtgcgcgcctgg
tcctccaccacgtcgcgcgagggcctgctcatcgcggacgcggagttgggagacgacagc
ggtctgattggcgcggcgttgctggtgaagtag

DBGET integrated database retrieval system