KEGG   Myxococcus xanthus: MXAN_6764Help
Entry
MXAN_6764         CDS       T00366                                 

Definition
alpha/beta hydrolase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
mxa  Myxococcus xanthus
Brite
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     MXAN_6764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
8313447..8314253
Genome map
AA seq 268 aa AA seqDB search
MDPRKTAPFELGRGEEVCLLLHGFTGSPWDVRPLGEALAVRGLRVVAPRLPGHGTTPQAL
LDVTWRDWLAAAEHALHALRGHRSVFVAGLSMGALLALELAARHPEEIRALTLMAPAVRF
RGPRMFLVRQLARTPVLEWTRPWVEKTGTDISDPEALAEAPVLPAFPVARLRDLCTLQTL
AIRDAARVRCPTLVAVAEQDHVVAPEGGRWLARRLTAAPSVRVLSLRQGYHVIPRDTAGP
LLAAEVGDFLAQQRSASWWESASPAAGA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
ttggacccgcgaaagacggcgcccttcgagctgggccggggcgaggaggtgtgcctgctc
ctgcacggcttcacggggagcccctgggacgtgcgccccctgggcgaggccctggcggtc
cgtgggctgcgcgtggtggcgccgcgcctgcccggccatggcaccaccccacaggccctg
ctcgacgtcacctggcgtgactggttggcggcggcggagcacgccctgcacgcgctccgg
ggccaccggagtgtgttcgtggcgggcctgtccatgggcgcgctgctggcgctcgagctg
gccgcgcggcatccggaggagatacgcgcgctgacgctgatggcgcccgccgtgcgcttc
cgggggccgcgcatgttcctggtccggcaactggcgcgcacgcccgtcctggagtggacg
cgtccgtgggtggagaagacgggcaccgacatctcggacccggaggcgctggcggaagcg
cccgtgctgcccgcctttcccgtggcccggttgcgggacctgtgcacgttgcagacgctg
gccatccgggacgcggcccgcgtgcgctgccccaccctggtggcggtggcggagcaggac
cacgtcgtggccccggagggagggcggtggctcgcacggcgcctcaccgcggcgccgtcg
gtgcgcgtcctgtcgctgcggcaggggtatcacgtcatccctcgggacacggcggggccc
ttgctggcggcggaggtcggagacttcctggcgcagcagcggagcgcctcgtggtgggag
tccgcgtcgcccgccgctggcgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system