KEGG   Myxococcus xanthus: MXAN_6771Help
Entry
MXAN_6771         CDS       T00366                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mxa  Myxococcus xanthus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MXAN_6771 (glpK)
Enzymes [BR:mxa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MXAN_6771 (glpK)
Exosome [BR:mxa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MXAN_6771 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
8322180..8323670
Genome map
AA seq 496 aa AA seqDB search
MPKAKYVLALDQGTTGTHVSILDTKLQVVGRSYKEFTQHFPKPSWVEHDLDEIWASSEWC
IARALKSAGLRGKDIAAIGITNQRETTGLWMRGSGQPLSHAIVWQDRRTAEQCRRLKEQG
VEPRVREVTGLVVDPYFSGTKLTWMFDHLKGARAKAEKGDVCFGTIDTWLVYKLTGGAAH
VTDVSNASRTLLMDLTTLQWSDEMRAMLSVPAACLPQIRGSAEVYGTTRGMRSLPDGIPV
AGMAGDQQAALFGQACFEPGESKCTYGTGAFLLMNTGSEPVRSSAGLLTTVAWRLGGTGT
TTYALEGSSFIAGAAVQWMRDGLKVIKRAPDIEALAASVKDSGDVVFVPALAGLGAPHWR
PEARGLFAGIDRSTTVAHMARAVLEGIALQIHDLAEAMRRDSGRDIPVFKADGGAAANNL
LMQFQADVLGVPLVRPRNLETTSLGAAFLGGLGAGIWDSPEAIRRAWKAEKTFKPKMKPD
ARERHLAKWKRAVERA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggcgaagtacgtcctggccctggaccagggcaccactggaacgcacgtctcc
atcctcgacacgaagctgcaggtggtcggccgctcctacaaggagttcacccagcacttc
cccaagccgtcctgggtggagcacgacctggatgaaatctgggccagcagtgaatggtgt
atcgcccgggcgctgaagagcgcgggccttcgcggcaaggacatcgccgccatcggcatc
accaaccagcgcgagacgacgggcctgtggatgcgcggcagcggacagccgttgtcccac
gccatcgtctggcaggaccgccgcaccgccgagcagtgccgccggctcaaggagcagggc
gtggagccgcgcgtgcgcgaggtgacggggctggtggtggacccgtacttctccggcacc
aagctcacgtggatgttcgaccacctgaagggcgcgcgcgcgaaggcggagaagggcgac
gtgtgcttcggcaccatcgacacctggctcgtctacaagctcaccggcggcgcggcgcac
gtcaccgacgtgtccaacgccagccgcacgctgctcatggatttgacgacgctccagtgg
agcgacgagatgcgcgccatgctgtccgtcccggccgcgtgcctgccgcagattcgcggc
tccgcggaggtgtacggcaccacgcgtggcatgcgcagcctgccggacggcatccccgtg
gcgggcatggcgggagaccagcaggccgcgctcttcggccaggcgtgcttcgagcccggc
gaatccaagtgcacctatggcaccggcgccttcctgctgatgaacaccggctcggagccg
gtgcgctcgtcggcgggcctgctcactaccgtagcgtggcggctgggcgggacgggcacc
accacgtacgcgctggagggcagcagcttcatcgccggcgcggcggtgcagtggatgcgc
gacgggctcaaggtcatcaagcgcgcgccggacatcgaagcgctggccgccagcgtgaag
gactccggggacgtggtcttcgtgcccgcgctggccggcctgggcgcgccacactggcgg
cccgaggcgcgcggcctcttcgctggcatcgaccgctccaccaccgtggcccacatggcg
cgcgcggtgctggagggcatcgcgctgcagattcatgacctggcggaggccatgcgccgc
gacagcgggcgggacatccccgtgttcaaggcggacggcggcgcggcggccaacaacctc
ctcatgcagttccaggcggatgtgctgggcgtgccgctggtgcgcccgcgcaacctggag
acgacgagcctgggcgcggcgttcctcggcggcctgggcgcgggcatctgggacagcccg
gaggccatccgccgcgcatggaaggcggagaagacgttcaagccgaagatgaagccggat
gcccgcgagcgacacctggccaagtggaagcgggccgtggagcgcgcgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system