KEGG   Myxococcus xanthus: MXAN_6771Help
Entry
MXAN_6771         CDS       T00366                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mxa  Myxococcus xanthus
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mxa00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
8322180..8323670
Genome map
AA seq 496 aa AA seqDB search
MPKAKYVLALDQGTTGTHVSILDTKLQVVGRSYKEFTQHFPKPSWVEHDLDEIWASSEWC
IARALKSAGLRGKDIAAIGITNQRETTGLWMRGSGQPLSHAIVWQDRRTAEQCRRLKEQG
VEPRVREVTGLVVDPYFSGTKLTWMFDHLKGARAKAEKGDVCFGTIDTWLVYKLTGGAAH
VTDVSNASRTLLMDLTTLQWSDEMRAMLSVPAACLPQIRGSAEVYGTTRGMRSLPDGIPV
AGMAGDQQAALFGQACFEPGESKCTYGTGAFLLMNTGSEPVRSSAGLLTTVAWRLGGTGT
TTYALEGSSFIAGAAVQWMRDGLKVIKRAPDIEALAASVKDSGDVVFVPALAGLGAPHWR
PEARGLFAGIDRSTTVAHMARAVLEGIALQIHDLAEAMRRDSGRDIPVFKADGGAAANNL
LMQFQADVLGVPLVRPRNLETTSLGAAFLGGLGAGIWDSPEAIRRAWKAEKTFKPKMKPD
ARERHLAKWKRAVERA
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaggcgaagtacgtcctggccctggaccagggcaccactggaacgcacgtctcc
atcctcgacacgaagctgcaggtggtcggccgctcctacaaggagttcacccagcacttc
cccaagccgtcctgggtggagcacgacctggatgaaatctgggccagcagtgaatggtgt
atcgcccgggcgctgaagagcgcgggccttcgcggcaaggacatcgccgccatcggcatc
accaaccagcgcgagacgacgggcctgtggatgcgcggcagcggacagccgttgtcccac
gccatcgtctggcaggaccgccgcaccgccgagcagtgccgccggctcaaggagcagggc
gtggagccgcgcgtgcgcgaggtgacggggctggtggtggacccgtacttctccggcacc
aagctcacgtggatgttcgaccacctgaagggcgcgcgcgcgaaggcggagaagggcgac
gtgtgcttcggcaccatcgacacctggctcgtctacaagctcaccggcggcgcggcgcac
gtcaccgacgtgtccaacgccagccgcacgctgctcatggatttgacgacgctccagtgg
agcgacgagatgcgcgccatgctgtccgtcccggccgcgtgcctgccgcagattcgcggc
tccgcggaggtgtacggcaccacgcgtggcatgcgcagcctgccggacggcatccccgtg
gcgggcatggcgggagaccagcaggccgcgctcttcggccaggcgtgcttcgagcccggc
gaatccaagtgcacctatggcaccggcgccttcctgctgatgaacaccggctcggagccg
gtgcgctcgtcggcgggcctgctcactaccgtagcgtggcggctgggcgggacgggcacc
accacgtacgcgctggagggcagcagcttcatcgccggcgcggcggtgcagtggatgcgc
gacgggctcaaggtcatcaagcgcgcgccggacatcgaagcgctggccgccagcgtgaag
gactccggggacgtggtcttcgtgcccgcgctggccggcctgggcgcgccacactggcgg
cccgaggcgcgcggcctcttcgctggcatcgaccgctccaccaccgtggcccacatggcg
cgcgcggtgctggagggcatcgcgctgcagattcatgacctggcggaggccatgcgccgc
gacagcgggcgggacatccccgtgttcaaggcggacggcggcgcggcggccaacaacctc
ctcatgcagttccaggcggatgtgctgggcgtgccgctggtgcgcccgcgcaacctggag
acgacgagcctgggcgcggcgttcctcggcggcctgggcgcgggcatctgggacagcccg
gaggccatccgccgcgcatggaaggcggagaagacgttcaagccgaagatgaagccggat
gcccgcgagcgacacctggccaagtggaagcgggccgtggagcgcgcgtga

DBGET integrated database retrieval system