KEGG   Myxococcus xanthus: MXAN_6777Help
Entry
MXAN_6777         CDS       T00366                                 

Definition
(GenBank) putative succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00300  Lysine biosynthesis
mxa01100  Metabolic pathways
mxa01120  Microbial metabolism in diverse environments
mxa01230  Biosynthesis of amino acids
Module
mxa_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    MXAN_6777
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MXAN_6777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABF92369
UniProt: Q1CXH9
Position
complement(8329066..8330154)
Genome map
AA seq 362 aa AA seqDB search
MASIDLATRLARTTLELCRIPSPITQEGPIADHVERWALQHFPREEVFRVGHTLLLGKLE
DARPTVALIGHLDTVPAHPSDAGREARIEGERVFGLGASDMKGGLAVMMALAEDLRRDTL
PVNLAFLFYEREEGAYAESGLIPLYEKRPDLAKVRFGIAMEPTDSVVQVGCVGSMQVTVR
FTGRSAHSARPWQGENAIHKAGPFLAELLGRQRVEVNVAGFPFYEVINATLAKGGRARNV
IPEAFELNLNYRFAPGKSIEQAKADVHALVAGRAEVEFTDASPSGPVVAGNPLFQKLMAL
TGLPAASKQAWTDVARFGEWGVDAINFGPGETAQAHQANESAPIAPLADAYEKLAAFLKG
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcgacctcgccacgcggctggctcgcaccacgctcgagctgtgccgcatc
cccagtcccatcacccaggaagggcccatcgccgaccatgtggagcgctgggcgctccag
cacttcccgcgggaagaggtgttccgagtcggccacacgctgctgctcggcaagctggag
gatgcgcgccccacggtggccctcatcggtcacctggacacggtgcccgcgcaccccagc
gacgcgggccgcgaggcgcgcatcgagggcgagcgcgtcttcgggctgggcgcctcggac
atgaagggcgggttggcggtgatgatggcgctcgcggaggatttgcgccgcgacacgctg
cccgtgaatctggccttcctcttctacgagcgcgaagagggcgcttacgccgaaagcggc
ctcatccccctgtatgagaagcggccggacctggcgaaggtgcggttcggcatcgccatg
gagcccaccgacagcgtggtgcaggtgggctgcgtcggctccatgcaggtcaccgtgcgt
ttcaccgggcgcagcgcgcactccgctcggccgtggcagggggagaacgccatccacaag
gcggggccgttcctcgccgagttgctcgggcgtcagcgcgtggaggtcaacgtcgcgggc
ttcccgttctacgaggtcatcaacgccacgctcgccaagggtggccgcgcgcgcaacgtc
atccccgaggccttcgagctgaacctcaactaccgcttcgcgccgggcaagagcatcgaa
caggcgaaggcggacgtgcacgcgctcgtcgccgggcgggccgaggtggagttcaccgat
gcgtcgcccagcggcccggtggtggcgggcaacccgctgttccagaagttgatggccctc
accggcctgcccgcggcctccaagcaggcctggacggacgtggcgcgcttcggcgagtgg
ggcgtggatgccatcaacttcgggcccggtgagacggcccaggcgcatcaggccaatgag
agcgcgcccatcgcgccgctcgcggacgcgtacgagaagctcgcggccttcctcaagggc
gcgagctga

DBGET integrated database retrieval system