KEGG   Myxococcus xanthus: MXAN_6777Help
Entry
MXAN_6777         CDS       T00366                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mxa  Myxococcus xanthus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MXAN_6777
  Amino acid metabolism
   00300 Lysine biosynthesis
    MXAN_6777
Enzymes [BR:mxa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     MXAN_6777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(8329066..8330154)
Genome map
AA seq 362 aa AA seqDB search
MASIDLATRLARTTLELCRIPSPITQEGPIADHVERWALQHFPREEVFRVGHTLLLGKLE
DARPTVALIGHLDTVPAHPSDAGREARIEGERVFGLGASDMKGGLAVMMALAEDLRRDTL
PVNLAFLFYEREEGAYAESGLIPLYEKRPDLAKVRFGIAMEPTDSVVQVGCVGSMQVTVR
FTGRSAHSARPWQGENAIHKAGPFLAELLGRQRVEVNVAGFPFYEVINATLAKGGRARNV
IPEAFELNLNYRFAPGKSIEQAKADVHALVAGRAEVEFTDASPSGPVVAGNPLFQKLMAL
TGLPAASKQAWTDVARFGEWGVDAINFGPGETAQAHQANESAPIAPLADAYEKLAAFLKG
AS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcttccatcgacctcgccacgcggctggctcgcaccacgctcgagctgtgccgcatc
cccagtcccatcacccaggaagggcccatcgccgaccatgtggagcgctgggcgctccag
cacttcccgcgggaagaggtgttccgagtcggccacacgctgctgctcggcaagctggag
gatgcgcgccccacggtggccctcatcggtcacctggacacggtgcccgcgcaccccagc
gacgcgggccgcgaggcgcgcatcgagggcgagcgcgtcttcgggctgggcgcctcggac
atgaagggcgggttggcggtgatgatggcgctcgcggaggatttgcgccgcgacacgctg
cccgtgaatctggccttcctcttctacgagcgcgaagagggcgcttacgccgaaagcggc
ctcatccccctgtatgagaagcggccggacctggcgaaggtgcggttcggcatcgccatg
gagcccaccgacagcgtggtgcaggtgggctgcgtcggctccatgcaggtcaccgtgcgt
ttcaccgggcgcagcgcgcactccgctcggccgtggcagggggagaacgccatccacaag
gcggggccgttcctcgccgagttgctcgggcgtcagcgcgtggaggtcaacgtcgcgggc
ttcccgttctacgaggtcatcaacgccacgctcgccaagggtggccgcgcgcgcaacgtc
atccccgaggccttcgagctgaacctcaactaccgcttcgcgccgggcaagagcatcgaa
caggcgaaggcggacgtgcacgcgctcgtcgccgggcgggccgaggtggagttcaccgat
gcgtcgcccagcggcccggtggtggcgggcaacccgctgttccagaagttgatggccctc
accggcctgcccgcggcctccaagcaggcctggacggacgtggcgcgcttcggcgagtgg
ggcgtggatgccatcaacttcgggcccggtgagacggcccaggcgcatcaggccaatgag
agcgcgcccatcgcgccgctcgcggacgcgtacgagaagctcgcggccttcctcaagggc
gcgagctga

DBGET integrated database retrieval system