KEGG   Myxococcus xanthus: MXAN_6952Help
Entry
MXAN_6952         CDS       T00366                                 

Gene name
cheB
Definition
protein-glutamate methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mxa  Myxococcus xanthus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mxa02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mxa02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
8506151..8507212
Genome map
AA seq 353 aa AA seqDB search
MKNDPLRILVAEDSPTARRLLVEIVRADPALTVVGEARDGVEAVELAQRLRPSLVTMDIQ
MPRMDGLEATRRIMTEVPTPVVVVSTLVERDIQTSMAALRAGALAVLQKPLGPESPDFDA
DSRRLRDTLKAMAEVKVVRRWPDRTAPPAPVPTPPAPPVSPTRPGVVALAASTGGPAALF
RLLSELPASFPVPLLVVQHIAIGFSEGLAQWLRTAGPLPVKVAEDGEPLLPGHVYLAPDD
RHLGVRGEGRAEVSRAAPVNGFRPSATWMFRSVARAYGPASLAVILTGMGQDGLEGVREL
HGAGGRILAQDEQSSVVYGMPGVVVGANLAHEVVALPDLASRLTSAFRGSGGV
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaagaacgacccgttgcgcatcctggtggccgaggactcgcccaccgcccgacgcctg
ctggtggaaatcgtccgcgccgaccccgccctgacggtggtgggcgaggccagggacggt
gtggaagcggtggagctggcccagcgcctgcggcccagcctggtgaccatggacatccag
atgccccggatggacggcctggaggccacccgccgcatcatgacggaggtgcccacgccg
gtggtggtggtgtccaccctggtggagcgcgacatccagacgtccatggccgcgctgcgc
gccggcgcgctcgcggtgctccagaagcccctgggcccggagtccccggacttcgacgcg
gacagccgccgcctgcgcgacaccctcaaggccatggccgaggtgaaggtggtgcgccgc
tggccggaccgcaccgcgccccccgcgcccgtgcccaccccgcccgcgccgcccgtgtcg
cccacgcgccccggcgtggtggccctggccgcctccacgggcggtcccgcggcgctcttc
cgcctcctgtccgagctgcccgccagcttccccgtccccctgctggtggtgcagcacatc
gccattggcttcagcgagggcctggcgcagtggctgcgcaccgcggggcccttgcccgtg
aaggtggcggaggatggcgagcccctgctccccgggcatgtgtatctggcgccggatgat
cgccacctgggcgtgcgaggcgaaggccgggcggaggtctcccgggccgcgccggtgaat
ggcttccggccgtccgcgacgtggatgttccgctcggtggctcgcgcctacgggcccgcg
tcgctcgccgtcatcctcaccggcatgggccaggacggactggaaggcgtgcgcgaactc
cacggcgccggaggccgcatcctggcccaggacgagcagtcctccgtcgtctacggcatg
cccggcgtggtggtgggcgccaacctggcccacgaagtcgtcgccctgcccgacctggcg
agccggctcacctcggctttccgcggtagcgggggagtctga

DBGET integrated database retrieval system