KEGG   Myxococcus xanthus: MXAN_6987Help
Entry
MXAN_6987         CDS       T00366                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mxa  Myxococcus xanthus
Pathway
mxa00071  Fatty acid degradation
mxa00280  Valine, leucine and isoleucine degradation
mxa00281  Geraniol degradation
mxa00310  Lysine degradation
mxa00362  Benzoate degradation
mxa00380  Tryptophan metabolism
mxa00410  beta-Alanine metabolism
mxa00640  Propanoate metabolism
mxa00650  Butanoate metabolism
mxa00903  Limonene and pinene degradation
mxa00930  Caprolactam degradation
mxa01040  Biosynthesis of unsaturated fatty acids
mxa01100  Metabolic pathways
mxa01110  Biosynthesis of secondary metabolites
mxa01120  Microbial metabolism in diverse environments
mxa01130  Biosynthesis of antibiotics
mxa01200  Carbon metabolism
mxa01212  Fatty acid metabolism
Module
mxa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MXAN_6987 (fadJ)
   00650 Butanoate metabolism
    MXAN_6987 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    MXAN_6987 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    MXAN_6987 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MXAN_6987 (fadJ)
   00310 Lysine degradation
    MXAN_6987 (fadJ)
   00380 Tryptophan metabolism
    MXAN_6987 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MXAN_6987 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MXAN_6987 (fadJ)
   00281 Geraniol degradation
    MXAN_6987 (fadJ)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MXAN_6987 (fadJ)
   00930 Caprolactam degradation
    MXAN_6987 (fadJ)
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MXAN_6987 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MXAN_6987 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MXAN_6987 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 F420_oxidored UDPG_MGDP_dh_N 2-Hacid_dh_C NAD_Gly3P_dh_N NAD_binding_2 AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ABF90251
UniProt: Q1CWX2
Position
complement(8545723..8547900)
Genome map
AA seq 725 aa AA seqDB search
MSEQNTIRWDKDADGIVVLTLDDPNQSANTMNAAYLKSMRATVDRLVKEKDTVAGVILTS
AKKTFFAGGDLKDLLKVRKEDAKQAFELGQEIKAQLRTLETLGKPVVAAINGAALGGGLE
IALACHHRIIADVKGAQVGLPEVTLGLLPGGGGVVRTVRMLGIVDALMKVLLQGQRYRPQ
EAKEAGLVHEVVDSVEALLPAAKAWVKAHPTAQQPWDQKGYKIPGGTPSSPGLAANLPAF
PANLRKQLKGANMPAPRAIMATAVESTQVDVDTAFTVESRYFTELVTGQVAKNMIQAFFF
DMQHINSGGGRPKGYPQHTAKKVGVLGAGMMGAGIAYVCAKAGIDVVLKDVSLASAEKGK
QYSVKLVEKAIQKGKSTKEKGDALLARIHPTTDAADLKGCDLVIEAVFEDVKLKHQVFQE
VQDVVAPDAVLGSNTSTLPISVLAEGVKRTEDFVGMHFFSPVDKMPLLELIAGKKTSDAT
LAKAIDIAVQIGKTPIVVNDSRGFFTSRVIGTFLNEAIAMVGEGISPASVEQAGLQAGYP
AAPLQLVDELTLTLPRKIRQETKAAILAEGKPWVEHRSYAVMDAMIDQHQRKGRSTGGGF
YDYVDGKRTGLWAGLAQHFTKPGHTIPFEDMKERMLFAEAVDTVRCFDEGVLRSAADANI
GSILGIGFPAWTGGVAQFINGYEGRTGNGPRGFIARARELAQRYGAHFEPPASLVEMAER
GEFLK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcagaacaccatccgctgggacaaggacgccgacggcatcgtcgtcttgacg
ttggatgacccgaaccagtccgcgaacaccatgaacgccgcgtacctgaagtccatgcgc
gcgacggtggaccggctggtcaaggagaaggacaccgtcgccggtgtcatcctcacctcc
gcgaagaagaccttcttcgccggtggtgatttgaaggacctgctgaaggtgcgcaaggag
gacgcgaagcaggccttcgagctggggcaggaaatcaaggcgcagctgcgcacgctggag
acgctgggcaagcccgtggtcgcggccatcaacggcgcggcgctgggcggcgggctggag
atcgcgctcgcgtgccaccaccgcatcatcgcggacgtgaagggtgcccaggtgggcctg
ccggaagtcacgctgggcctcttgcctggcggtggcggcgtggtgcgcacggtgcggatg
ctgggcatcgtggacgcgctgatgaaggtgctgctccagggccagcgctaccgcccgcag
gaggcgaaggaggccggcctggtccatgaggtggtggactccgtggaggcgctgctgccc
gcggccaaggcgtgggtgaaggcccatcccaccgcgcagcagccgtgggaccagaagggc
tacaagattccgggcggcacgccgtcgtctccggggctggcggcgaacctgcccgcgttc
cccgcgaacctgcgcaagcagctcaagggcgcgaacatgccggcgccccgcgccatcatg
gccacggccgtggagagcacgcaggtggacgtggacaccgcgttcaccgtggagtcgcgc
tacttcaccgagctcgtcaccgggcaggtcgcgaagaacatgattcaggcgttcttcttc
gacatgcagcacatcaactccggtggcggccgtcccaagggctacccgcagcacaccgcg
aagaaggtgggcgtgctgggcgcggggatgatgggcgcgggcatcgcctacgtctgcgcc
aaggccggcatcgacgtggtgctcaaggacgtgagcctcgcgtcggcggagaagggcaag
cagtactccgtgaagctggtggagaaggccatccagaagggcaagtccacgaaggagaag
ggggacgcgctgctggcgcgaatccaccccaccacggacgccgccgacctcaaggggtgt
gacctcgtcatcgaggccgtgttcgaggacgtgaagctcaagcaccaggtcttccaggaa
gtgcaggacgtggtcgccccggacgcggtgctcgggtccaacacgtccacgctgcccatc
tccgtgctcgccgagggcgtgaagcggacggaggacttcgtgggcatgcacttcttctcg
cccgtggacaagatgccgctgctggagctcatcgcgggcaagaagacgagcgacgccacg
ctcgcgaaggccatcgacatcgcggtgcagattgggaagacgcccatcgtcgtcaacgac
agccggggcttcttcaccagccgcgtcatcggcaccttcctcaacgaggccatcgccatg
gtgggcgagggcatctcgcccgcctccgtcgagcaggccggcctccaggcgggctacccc
gccgccccgctccagttggtggacgaactcacgctgacgctgccgcgcaagattcgtcag
gagacgaaggcggccatcctggcggagggcaagccctgggtggagcaccgcagctacgcc
gtgatggacgcgatgattgaccagcaccagcgcaagggccgctccaccggcggcgggttc
tacgactacgtggacggcaagcgcacgggcctatgggcgggactggcgcagcacttcacc
aagcccggccacaccatccccttcgaggacatgaaggagcggatgctgttcgccgaggcc
gtcgacacggtgcgctgcttcgacgaaggcgtgctgcgctccgccgcggacgcgaacatc
ggctccatcctcggcatcggcttcccggcatggacgggcggcgtggcgcagttcatcaac
ggctatgagggccggacgggcaacgggccgcggggcttcattgcccgcgcgcgggagctc
gcgcagcgctacggtgcgcacttcgagccgccggcgtcgctcgtcgagatggccgaaaga
ggcgaattcttgaagtag

DBGET integrated database retrieval system