KEGG   Myxococcus xanthus: MXAN_7090Help
Entry
MXAN_7090         CDS       T00366                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mxa  Myxococcus xanthus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mxa00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MXAN_7090
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MXAN_7090
Enzymes [BR:mxa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MXAN_7090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8662278..8662829
Genome map
AA seq 183 aa AA seqDB search
MSQNLYDIPLKSIDGAPQSLGQFKGKVLLVVNVASKCGLTPQYEGLEKLYERKRAEGFEV
LGFPANNFLGQEPGSESEIKAFCTLTYDVKFPLFSKISVVGADKHPLYHALTGAIPDAVG
EGPMRSRLQGYGITANPVPEVQWNFEKFLVGRDGRVAARFAPDVAADDARLLSAIDAELA
KQA
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgagccagaacctctacgacattcccctcaagtccatcgatggtgccccgcagtcgctc
ggccagttcaagggcaaggtcctgctggtggtcaacgtggcctccaagtgcggactgacg
ccgcagtacgaaggcctggagaagctctacgagcgcaagcgcgccgagggcttcgaggtg
ctgggcttcccggccaacaacttcctgggccaggagccgggcagcgagtcggaaatcaag
gcgttctgcacgctgacctacgacgtgaagttcccgctgttctccaagatttcggtggtg
ggcgcggacaagcacccgctctaccacgcgctgacgggcgccatcccggacgccgtgggc
gaaggccccatgcgcagccggctccagggctacggcatcaccgccaaccccgtgccggaa
gtgcagtggaacttcgagaagttcctcgtcgggcgtgacggccgcgtcgccgcgcgtttc
gcgccggacgtcgccgcggatgatgcgcgtctgctgtccgccatcgacgcggagctcgcg
aagcaggcttga

DBGET integrated database retrieval system