KEGG   Myotis brandtii (Brandt's bat): 102238706Help
Entry
102238706         CDS       T02920                                 

Gene name
ELP3
Definition
elongator acetyltransferase complex subunit 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102238706 (ELP3)
Transfer RNA biogenesis [BR:myb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    102238706 (ELP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 534 aa AA seqDB search
MMLTIGDVIKQLIEAHEQGKDIDLNKVKTKTAAKYGLSAQPRLVDIIAAVPPQYRKVLVP
KLKAKPIRTASGIAVVAVMCKPHRCPHISFTGNICVYCPGGPDSDFEYSTQSYTGYEPTS
MRAIRARYDPYLQTRHRIEQLKQLGHSVDKVEFIVMGGTFMALPEEYRDYFIRNLHDALS
GHTSNNIYEAVKYSERSLTKCIGITIETRPDYCMKRHLSDMLTYGCTRLEIGVQSVYEDV
ARDTNRGHTVKAVCESFHLAKDSGFKVVAHMMPDLPNVGLERDIDQFIEFFENPAFRPDG
LKLYPTLVIRGTGLYELWKSGRYKSYSPSDLIELVARILALVPPWTRVYRVQRDIPMPLV
SSGVEHGNLRELAFARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRRDYVANGGWE
TFLSYEDPDQDILIGLLRLRKCSEETFRFELVGGVSIVRELHVYGSVVPVSSRDPTKFQH
QGFGMLLMEEAERIAREEHGSGKIAVISGVGTRNYYRKIGYRLQGPYMVKTLKY
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgaccataggagatgttatcaaacaactaattgaagcccacgaacaggggaaa
gacatcgatctaaataaggtgaaaaccaagacagctgccaaatatggcctttcagcacag
cctcgcctggtggatatcattgccgcagtcccacctcagtatcgaaaggttttggtcccc
aagttaaaggcaaaacccatcagaactgcgagtgggattgctgttgtagctgtgatgtgc
aaaccccacagatgtccacacattagttttacaggaaatatttgtgtatactgccctggt
ggacctgattcagattttgagtattcaacccagtcttatactggatatgagccaacctcc
atgcgagctattcgtgcaagatacgatccttatctacagacaagacaccgcatagagcag
ttgaaacagcttggtcacagtgtggataaagtggagtttattgtgatgggtggaacattt
atggcccttcctgaagaatacagagattattttatacgcaacttacatgatgccttgtca
ggacatacctctaacaatatttacgaggcagtcaagtattctgagaggagcctcacaaag
tgtattggaattactattgagacgagacctgattattgcatgaagcggcatttaagtgac
atgctgacctatggctgtaccaggctggagattggggtgcagagtgtctacgaagatgtg
gccagagataccaacaggggccacactgtgaaggcagtctgtgagtcattccacctggcc
aaagattcaggtttcaaagttgtggctcatatgatgcctgatctgccaaacgtgggactc
gagagagacatcgatcagtttatagagttttttgagaaccctgcttttcgtcccgatggt
ttaaaactttacccgaccctggtgattcgtggaactgggctttatgagctgtggaaatca
ggacgctataagagttattcgcctagtgacctgatcgaattggtggctcggatccttgcc
cttgtgcctccatggactcgagtgtaccgcgtgcagagggatattccaatgcccttagtc
agctcaggagtcgagcacggtaatttgagagagctggcattcgcaagaatgaaggacctg
ggaatacagtgtcgagatgtgagaaccagagaggttggaattcaagaaattcatcacaaa
gtacggccatatcaggttgagttggtaaggagagattatgttgcaaatggtggctgggaa
acattcttatcatacgaagacccagatcaagacattttgattggcctcctgcgattacga
aagtgttcagaggaaaccttccgttttgaattggttggaggtgtttccatagtccgagag
ctgcatgtgtatgggagtgtagtccctgtgagcagtcgggatcctactaagtttcagcat
cagggatttggcatgctgctgatggaggaagcagaaagaatagctagagaagaacatggg
tctgggaaaatagctgttatatcaggggttggcaccaggaattattacagaaagattggc
taccggttacaaggcccatacatggtgaagacgctaaaatattag

DBGET integrated database retrieval system