KEGG   Myotis brandtii (Brandt's bat): 102240086Help
Entry
102240086         CDS       T02920                                 

Gene name
KAT8
Definition
(RefSeq) lysine acetyltransferase 8
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102240086 (KAT8)
Chromosome [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102240086 (KAT8)
   HAT complexes
    NSL complex
     102240086 (KAT8)
    MSL complex
     102240086 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 398 aa AA seqDB search
MRIGELFSFPDSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQ
KNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVD
KIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEI
YRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVG
YFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLS
YRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPK
LVEEHLKSAQYKKPPITVDSLCLKWAPPKHKQVKLSKK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcggataggagagcttttctccttcccagattctgctgaagtgatccagtctcgagtg
aatgaccaggagggccgagaggaattctatgtgcactatgtgggctttaaccggcgacta
gacgaatgggtagacaagaaccggctggcactgaccaagactgtgaaggatgccgtgcag
aagaactcggagaagtacctgagcgagctggccgagcagcctgaacgcaagatcactcga
aaccaaaagcgcaagcatgatgagatcaaccatgtacagaagacctatgcagagatggac
cctacaacagcagctttggagaaagaacacgaggcgatcaccaaggtgaagtatgtggac
aagatccacatcgggaactacgaaatcgatgcctggtacttctcaccgttccccgaagac
tatgggaagcagcccaagctctggctctgcgagtactgcctcaagtacatgaagtatgag
aagagctaccgcttccacctgggccagtgtcagtggcggcagcccccaggaaaggagatc
taccgcaagagcaacatctctgtgtacgaggtggatggcaaagaccacaagatttactgt
cagaacctgtgtcttctggccaagcttttcctggaccacaaaacattgtacttcgacgtg
gagcccttcgtcttttatatcttgactgaggtcgacaggcagggggcccacatcgtcggc
tacttctcaaaggagaaggagtctccagatggaaacaatgtggcctgcatcctgaccctg
cctccctaccagcgccgcggctacggaaagttcctcattgctttcagttatgagctatcc
aagctagagagcacagtaggctcccctgagaagccactgtccgacctgggcaagctcagc
taccgcagctactggtcttgggtcctgctggagattctgcgagacttccgtggcacgctg
tccatcaaggacctgagccagatgaccagcatcactcagaatgacatcatcagcacctta
cagtccctcaacatggtcaagtactggaaaggccagcatgtcatctgtgtcacacccaag
ctagtagaggagcacctcaaaagtgctcagtataagaaaccacccataacagtggactct
ctttgcctcaagtgggcaccccccaagcacaagcaagtcaaactttccaagaagtga

DBGET integrated database retrieval system