KEGG   Myotis brandtii (Brandt's bat): 102241174Help
Entry
102241174         CDS       T02920                                 

Definition
beta-galactoside alpha-2,6-sialyltransferase 2-like
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102241174
   00514 Other types of O-glycan biosynthesis
    102241174
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     102241174
Glycosyltransferases [BR:myb01003]
 Terminal extension
  Sialyltransferase
   102241174
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 478 aa AA seqDB search
MKPPLKQWRQLMLCGIFTWGLLFLVIFIYFTDNNPAEPAPSSLAFLETRRLLPMQGKQRV
IMGAMQEPSWPESVNTNKGLLEGHPMGPRDLQKWAKLPDGVENEEEFFLSQIGRKSQSTF
YPEDDDYFFAAGQPGSHSHTQGTLESLAPRHAGRWKGWLPERKRHQPQGSSPALEEGEEG
DRLYSSMSRAFLHRLWKGTVSSKMLNPRLQKAMKDYLAANKHGVRFRGGGRALVPPVPLG
QLHPKGLRSCAVVMSAGAILNSSLGEEIDSHDAVLRFNAAPTRGYERDVGNKTTVRIINS
QILTNPNHHFIDSSLYKDVILVAWDPAPYSANLDLWYKKPDYNLFTPYVQHRQRNPDQPF
YILHPKFVWQLWDIIQENTKEKIQPNPPSSGFIGILLMMSLCSEVHVYEYLPSVRQTELC
HYHELYYDAACTLGAYHPLLYEKLLVQRLNTGAQGDLHRKGKVVLPGLRAVHCPTSNS
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacccttgaagcaatggagacaactaatgctttgtgggatatttacttggggg
ctcctcttcctggtgattttcatttacttcaccgacaacaaccctgctgagcccgcgccc
agctcccttgccttcctggagactaggaggctcttgcccatgcaggggaagcagagggtc
attatgggtgccatgcaggagccctcctggcctgaaagcgtgaacacaaacaaggggctg
ctggagggacaccccatggggcctcgcgacctgcagaaatgggccaagttgccagatggg
gttgaaaatgaagaagagttctttttatcccagattgggagaaaatcccaaagtaccttc
tatccagaagacgacgactacttttttgctgccggtcaaccagggtctcacagccacact
caggggacactggagtcccttgcccccaggcacgctggcaggtggaaggggtggttgcca
gagaggaaaaggcaccagccccaggggagcagccccgcgctggaggagggagaggaagga
gacaggctgtactcctccatgtccagggccttcctgcatcggctctggaagggcaccgtc
tcctccaagatgctcaatccgcgcctgcagaaagccatgaaggactacctggcggccaac
aagcacggagtgcgcttccgcgggggcgggcgggcgctggtgccccctgtgccccttggc
cagctgcaccccaaaggcctgcgctcctgcgctgtggtcatgtctgccggtgccatcctc
aactcctccttgggggaggagatagattctcatgatgcagtcttgagatttaacgcggct
cccacccgtggctatgagagagatgttgggaataaaaccactgtgcgcatcattaattcc
cagattctgaccaaccccaaccatcacttcattgacagttcattatataaagatgtcatt
ttggtggcctgggaccctgctccttattctgcaaatcttgacctgtggtacaagaagcca
gattacaacctgttcacaccatatgttcagcatcgtcagaggaacccagatcagcccttc
tacattcttcaccctaaatttgtatggcagctttgggacatcatccaggagaacaccaag
gagaagattcagcccaacccaccatcttctggcttcattggaatcctcctcatgatgtcc
ttgtgcagtgaggtgcacgtgtacgaatacctcccgtccgtcaggcagacggagctgtgc
cactaccacgagctgtactacgacgcggcctgcacactcggggcctaccaccccctgctc
tacgagaagctgctggtgcagcgcctgaacactggcgcccaaggggacctgcaccgcaag
ggcaaggtggttctgccagggctgcgggctgtgcactgccccacctccaactcttga

DBGET integrated database retrieval system