KEGG   Myotis brandtii (Brandt's bat): 102241821Help
Entry
102241821         CDS       T02920                                 

Gene name
CES1
Definition
(RefSeq) liver carboxylesterase 1
  KO
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102241821 (CES1)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     102241821 (CES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 702 aa AA seqDB search
MTYNNIGNCHCYHYCGQVLGEYVSLEGFAQPVAVFLGVPFAKPPLGPLRFAPPQPAEPWT
FVKNATSYPPMCSQDAPSDQVLSRLFTKRKAKIPLKFSEDCLYLNIYTPAHLKKKSRLPV
MVWIHGGGLVVGGASTYDGLALSAHENVVVVIIQYRLGIWGFFSTGDEHSRGNWGHLDQL
AALRWVQENIANFGGDAGSVTIFGASAGAESVSVLVLSPLAKNLFHRAISESGVSFTTGL
VKKDIKATAQQIATFAGCQTTTSAVMVHCLRQKSEEELMETSLKMGSMDTVMSSSQSPPF
LSSVVDGVLLPKMPEELLAEKQLNSVPYIVGINQQEFGWILPMMMGYPISEGKLDQKTAS
SLLWQSYPNIPEALIPAVIEKYLGGTDDPVKKKDWFLELLADVVFGVPSVTVARGHRGES
QRLDRKGHQPHPLRCLSCPPLSIDRPPRLVPCGQGWGAVLFWFLPEADSEKRIQMPLVYL
EGQVLGEYVSLEGFAQPVAVFLGVPFAKPPLGPLRFAPPQPAEPWTFVKNATSYPPMCSQ
DAMSAQVLSELFSFRKENIPLKFSEDCLYLNIYTPADLSRKSRLPVMVWIHGGGLVVGGA
SSTYGLALSAHENVVVVIIQYRLGIWGFFSTGDEHSRGNWGHLDQLAALRWVQENIANFG
GDPGSVTIFGESAGGASVSVLVSVPGPDEASDGLPGRSADHY
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgacctataacaacatagggaactgccactgttaccattactgcggccaggtcctgggg
gagtatgtcagcctagaaggctttgcacagcccgtggccgttttcctgggagtccccttt
gccaagccgccgctcggacccctgaggtttgctcctccgcagcctgcagagccatggacc
ttcgtgaagaacgccacctcctaccctcctatgtgctcccaagatgccccgtcggaccag
gttctctcaaggctctttaccaaaagaaaggcgaagattcctctcaagttctccgaagac
tgcctttacctaaacatctacactcccgcacacttgaagaagaagagcaggctgccggtg
atggtgtggatccatggaggaggtctggtggtaggcggggcatcaacctatgatgggctg
gccctctctgcccatgaaaacgtggtggtggtgatcattcagtaccgcctgggcatctgg
ggattcttcagcacaggggatgaacacagccggggcaactggggtcacttagaccagctg
gccgcgctgcgctgggtccaggagaacatcgccaattttggaggggacgcaggctccgtg
accatcttcggagcctccgcgggagctgaaagtgtctccgttcttgtgttatctcccctg
gccaagaatctcttccaccgggccatctctgagagtggtgtgtccttcaccactggcctg
gtcaagaaagacatcaaggccacagctcagcaaatcgctacctttgccggctgtcaaacc
accacctcggcggtcatggtgcactgcctgcgccagaagtcggaggaggagctcatggag
acgtcgctgaagatgggcagcatggacactgttatgtcctcttcccagagcccgcccttc
ctgtcctctgtggttgatggagtgctgctgccgaagatgccggaggagcttctggctgaa
aagcagctcaactccgttccgtatatcgtcggaatcaaccagcaagagttcggctggatt
cttcctatgatgatgggttacccgatctctgaaggcaagctggaccagaagacggcctca
tcactcttatggcagtcctaccccaacatccctgaggcactgatcccagcggtcattgag
aagtatttaggagggacagatgaccctgtcaaaaagaaagactggttcttggagttgctg
gcagatgtggtatttggtgtcccatctgtgactgtggcacgtggccacagaggtgagtcc
cagagattggacaggaagggacaccaaccccacccacttcgctgtctgtcctgcccaccc
ctcagcatagacaggcctccgaggctggttccatgtggccaggggtggggcgctgtcctg
ttttggtttctgccagaagcggactctgagaaaaggatccaaatgccgctagtttatttg
gagggccaggtcctgggggagtatgtcagcctagaaggctttgcacagcccgtggccgtt
ttcctgggagtcccctttgccaagccgccgctcggacccctgaggtttgctcctccgcag
cctgcagagccatggaccttcgtgaagaatgccacctcctaccctcctatgtgctcccaa
gatgccatgtcagcccaggttctctcggagctcttttccttcagaaaggagaacattcct
ctcaagttctccgaagactgcctttacctaaacatctacactcccgccgacttgagcagg
aagagcagactgccggtcatggtgtggatccacggaggaggtctggtggtgggcggggca
tcatcaacctatgggctggccctctctgcccatgaaaacgtggtggtggtgatcattcag
taccgcctgggcatctggggattcttcagcacaggggatgaacacagccggggcaactgg
ggtcacttagaccagctggccgcgctgcgctgggtccaggagaacattgccaactttgga
ggggacccaggctccgtgaccatcttcggagagtccgcaggaggtgcaagtgtctctgtt
cttgtaagtgttcctggccctgatgaggcttcggatggactccctgggagatccgccgac
cattactaa

DBGET integrated database retrieval system