KEGG   Myotis brandtii (Brandt's bat): 102243034Help
Entry
102243034         CDS       T02920                                 

Gene name
NCOA3
Definition
(RefSeq) nuclear receptor coactivator 3
  KO
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Endocrine resistance
Thyroid hormone signaling pathway
Pathways in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102243034 (NCOA3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102243034 (NCOA3)
   05224 Breast cancer
    102243034 (NCOA3)
  Drug resistance
   01522 Endocrine resistance
    102243034 (NCOA3)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102243034 (NCOA3)
Chromosome [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102243034 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1430 aa AA seqDB search
MSGLGENSLDPLVPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKAISNDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVTWTNETQRQKSHTFNCRMLMKTPHDIVEDMNTSPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKLVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRQNPNPVGQGIRPPAAGCNSVGGMSMSPNQGLQMLNSRAYGLA
DPGTTGQMSGARYGASSNIATMNPGPAMQSPSSYQNNNYGLNMSSPPHGSPGLGSNQQNI
MISPRNRGSPKMASHQFSPVAGVHSPIGSSGNTGSHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVNSQDSKSPLSLYCDQNPVESSMCQSNSRDHLNDKDSKE
SNVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSISVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSATFCVEGN
VKQEQLSPKKKENNALLRYLLDRDDPSDTLSKEVQPKVEGVDNKMSQCSSSTVPSSSQEK
DAKIKTEANEEGSGDLDNLDAILGDLTSSDFYNNSVSTNGSNLGTKQQMFQGTNSLGLRS
PQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNITAFPMLPKQPMLGGNPRMMDSQENYGSN
MGGPNRNVTMNQTPSSGDWGLSNSKASRMESMSSNSMGRPGADFNASLPRPTMGGSMPTL
PLRSNSIPGARPMLQQQQQQQQQQQQQQQQQQQHQQQQQHQQMLQMRPGEIPMGMGVSPY
GPAAPSNQSGSWPDGMLSMEQGPHGTQNRPLFRNSLDDLLGPPSNLEGQNDERALLDQLH
TLLSNTDATGLEEIDRALGIPELVNQGQALEPKQDVFQGQEATVMMDQKAAFYGQMYPAQ
GTPMQGGFNLQGQSPSFNSMMSQMNQQGNFPLQGMHPRANLMRPRTNTPKQLRMQLQQRL
QGQQFLNQSRQALEMKMENPTAGGAAMMRPMMQPQVNSQQGFLNAQMVAQRSRELLSHHF
RQQRVAAMMMQQQQQQQQQQQQTQAFSPPPNVTASPSMDGVLAGPAIPQAPPQQFPYQPN
YGMGQQPDPAFGRVSSPPNAMMSSRMGPSQNPMMQHPHTAPMYQSSEMKGWPSGNLARNS
SFPQQQFAHQGNPAAYNMVHMNGSSGPMGQMNMNSMPMSGMPMGPEQKYC
NT seq 4293 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaactccttggatccactggtccctgattcacgaaagcgcaaa
ttgccatgtgataccccaggacaaggtcttacctgcagtggtgaaaagtggagacgggag
caggagagtaaatacattgaagaattggctgaactgatatctgctaatcttagtgatatt
gacaatttcaacgtcaaaccagataaatgtgcaattttgaaggaaacagtaagacagata
cgccaaataaaagagcaaggaaaagctatttccaatgatgatgatgttcagaaagctgat
gtatcttctacaggacagggggttattgataaagactccttaggaccacttttacttcag
gcattggatggtttcctgtttgtggtgaatcgtgatggaaacattgtatttgtgtcagaa
aatgtcacacaatatctgcaatataagcaagaggacctggttaacacaagtgtctataat
atcttgcatgaagaagatagaaaggatttccttaaaaacttaccaaaatctacagttaat
ggagttacctggacaaatgagacccagagacaaaaaagccatacatttaattgccgtatg
ttgatgaaaacaccacatgatattgtggaagacatgaacactagtcctgaaatgcgccag
agatatgaaaccatgcagtgctttgccctgtctcagccacgagctatgatggaggaaggg
gaagatttgcaatcctgtatgatctgtgtggcacgccgcattactacaggagaaagagca
tttccatcaaaccctgagagctttattactagacatgatctttcaggaaaacttgtcaat
atagatacaaattcactgagatcctctatgagacctggctttgaagatataattcgaagg
tgtatccagagattttttagtcttaatgatgggcagtcatggtctcagaaacgtcactat
caagaagcttatattcatggccatgcagaaactccagtgtatcgattctctttggctgat
ggaactatagtgactgcacaaacaaaaagcaaactcttccgaaatcctgtaacaaatgat
cgtcatggttttgtctcaacccactttcttcagagggaacagaatgggtatagacagaac
ccaaatcctgttggacaaggcattagacctccagcggctggatgtaattcggtaggtggc
atgagcatgtcaccaaaccaaggcttacagatgctgaacagcagggcctatggcttggct
gaccctggcaccacagggcaaatgagtggagctaggtatggggcttccagtaacatagcc
acaatgaaccctgggccagccatgcagtcaccatcttcctaccagaacaacaactatggt
ctcaacatgagtagccccccacatgggagtcctggtcttggctccaaccagcagaatatc
atgatttctcctcgtaaccgcgggagtccgaagatggcctcacatcagttttctcctgtt
gcaggtgtgcactctcctattggatcttcgggcaatactgggagccacagcttttccagc
agctcgcttagtgcccttcaagctatcagtgagggtgtggggacgtctcttttatctact
ttgtcttcaccaggccctaaattggacaactctcccaatatgaatataactcaaccaagt
aaagtgaacagtcaggattcaaaaagtcccttaagcttgtattgtgaccagaatccagtg
gagagttcaatgtgtcagtcaaatagcagggatcacctcaatgacaaagacagtaaggag
agcaatgttgaaggatcagagaatcagcggggtcctctggaaagcaaaggtcataaaaaa
ttactgcagttacttacctgttcttctgatgaccggggtcattcctctttgaccaactcc
cccctggattcaagttgtaaagactcttccattagtgtcaccagcccctctggggtctcc
tcttcaacgtctggaggagtgtcctccacatccaatatgcatgggtcactgctgcaagag
aagcaccggattttgcacaagttgctgcagaatggcaattcaccagctgaagtggccaag
attaccgcagaagccactggaaaagacactagcagtgcaacattctgtgtggaaggaaac
gtcaagcaggagcaactaagtcctaagaagaaggaaaataatgccctgctcagatacctg
ctagacagggacgatcctagtgacacactctctaaagaagtacagcccaaagtggaggga
gtagacaacaaaatgagtcagtgcagcagctccactgtgcctagctcgagccaagagaaa
gacgctaaaattaagacagaagcaaatgaagagggatctggagatttggataatctagat
gcaattcttggggatctgactagttctgacttttacaataattctgtatctacaaatggt
agtaatctgggaaccaagcaacaaatgtttcaaggaactaattctctgggtttgaggagt
ccacagtctgttcagtccattcgtcctccatacaaccgagcagtgtctctagatagccct
gtttctgttggctcaagtcctccagtaaagaatatcactgctttccccatgttaccaaag
caacccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctcaaat
atgggtggaccaaacagaaacgtgactatgaatcagactccttcctctggagactggggc
ttgtcaaactcaaaggccagtaggatggaatccatgagttcaaattccatgggaagacca
ggagcagattttaatgcttctttacccagacctacaatgggtggctcgatgcccaccttg
cctcttcggtccaatagcattcctggtgcaagaccaatgttgcagcagcagcagcagcaa
cagcagcagcagcagcaacagcagcaacagcaacagcaacatcaacagcaacagcaacat
cagcagatgcttcaaatgcggcctggtgaaattcccatgggaatgggggtcagtccttat
ggcccagcagcaccatctaaccaatcaggttcctggccagacggcatgttgtccatggaa
caaggccctcatgggactcaaaataggccactcttcaggaattctctggatgatcttctt
gggccaccttctaacctagaaggacagaacgatgaaagagcattgttggaccagctgcac
acgctcctaagcaacaccgatgccacaggcttagaagaaattgacagagctctgggcatc
cctgaacttgtaaatcaaggacaagctttggagcccaaacaggatgttttccaaggccaa
gaagcaacagtaatgatggatcagaaggcagcattttatgggcagatgtatccagcacag
gggactccaatgcaaggaggctttaatcttcagggacaatcaccatcttttaactctatg
atgagtcagatgaaccagcaaggcaattttcctctccagggaatgcatcctagggccaac
ctcatgagacctcggacaaacacccccaagcaacttagaatgcagcttcagcagaggcta
cagggccaacagtttttgaatcagagccggcaggcactggaaatgaaaatggaaaacccc
actgctggtggagcggcaatgatgaggcccatgatgcagccccaggtgaactcccagcag
gggtttcttaatgcccagatggttgcccagcgcagcagggagctgctaagtcatcacttc
cgacagcagagggtggcggcgatgatgatgcagcagcagcagcagcagcagcagcagcag
cagcagacccaggccttcagcccaccccctaacgtgaccgcctcccccagcatggatggg
gttttggcagggcctgccataccacaggctccaccccagcagtttccatatcaaccaaat
tatggaatggggcaacaaccagatccagcctttggtcgagtgtccagtcctcctaatgca
atgatgtcatcaagaatgggtccctcccagaatcctatgatgcagcaccctcacaccgca
cctatgtatcagtcctcggaaatgaaaggctggccatcaggaaacctggccaggaacagc
tccttcccccagcagcagtttgcccaccaggggaatcctgcagcatataatatggtgcac
atgaatggcagcagtggtcccatgggacagatgaacatgaactccatgcccatgtctggc
atgcccatgggccctgagcagaaatactgctga

DBGET integrated database retrieval system