KEGG   Myotis brandtii (Brandt's bat): 102243087Help
Entry
102243087         CDS       T02920                                 

Gene name
NCOA1
Definition
(RefSeq) nuclear receptor coactivator 1
  KO
K09101  nuclear receptor coactivator 1 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04915  Estrogen signaling pathway
myb04919  Thyroid hormone signaling pathway
myb05200  Pathways in cancer
myb05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    102243087 (NCOA1)
   04919 Thyroid hormone signaling pathway
    102243087 (NCOA1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102243087 (NCOA1)
   05224 Breast cancer
    102243087 (NCOA1)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102243087 (NCOA1)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102243087 (NCOA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 DUF1518 NCOA_u2 SRC-1 Nuc_rec_co-act PAS PAS_3 DUF4927 PAS_9 HLH PAS_4
Motif
Other DBs
NCBI-GeneID: 102243087
NCBI-ProteinID: XP_005874975
UniProt: S7N7Y5
Position
Un
AA seq 1440 aa AA seqDB search
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTADDEVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENPEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREASYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSINPTISPAHGVARSSSLPPSNSNMVSTRVNR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVAGVALNQGQASSQSTNPSLNLNNSPMEGTG
VSLAQFMSPRRQVSSGLATRPRMPNNSFPPNIPTLSSPGGMTSTACNNSNRSYSNIPGAS
LQSMSEGPNNSVGFSASSPVLRQISSQNSPSRLNMQPAKAESKDNKEIASILNEMIQPDN
SSSDGKPLDSGLLHNNDRLSDGDNKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKEVLSC
TGTSNSAAANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDLTTLSVEPDKKDSAPASVS
VTGQAQGNSIKLEMDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQM
DPCNTNPTPMTKPAPEEIKLESQNQFTADLDQFDQLLPTLEKAAPLPGLCETERMDGAVS
GVTIKSEILPASLQATTARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNTTVTAVNQ
NKPEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKLV
QGGGLDVLSERFPPQQATPPLMMEERPNLYPQPYSSPSPTASLTSPFQGMVRQKPSLGSM
PVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQFA
ANAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSFG
NNLPPASGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAVNPEATLANR
NSMVNRGMAGNMGGQFGTGVNPQMQQNVFQYPGSGMVPQGEASFAPSLSPGSSMVPMPIP
PPQSSLLQQTPPASGYQSPDMKAWQQGAMGNNNVFSQAVQNQPAPAQPGVYNNMSITVSM
AGGNTNVQNMNPMMGQMQMSSLQMPGMNTVCPEQISDSALRHTGLYCNQLSSTDLLKTEA
DGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTAGPQTPQAQQKSLLQQLLTE
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctcggggacagttcatccgaccctgctaacccagactcacataagagaaaa
ggatctccttgtgacacactggcatcaagcactgaaaagaggcgcagggagcaagaaaat
aaatacttagaagagctagctgagttattgtctgcaaacatcagtgacattgacagcttg
agtgtaaaaccagacaaatgcaagattttgaagaagacagtcgatcaaatacagctaatg
aaaaggatggaacaagagaaatcaacagctgatgatgaagtgcagaagtcggacatctca
tcgagtagtcaaggagtgatagaaaaggagtccttgggacctcttcttttggaggctttg
gatggatttttctttgttgtgaactgtgaagggagaattgtatttgtgtcagagaatgtg
accagctacttgggttacaatcaggaagaattaatgaataccagtgtctacagcatactg
catgtgggggatcatgctgaatttgtgaagaatctgctaccaaaatcactagtaaatgga
gttccttggcctcaagaggcaacacgacgaaatagccatacctttaactgcaggatgcta
attcaccctccagatgagccaggcactgagaacccagaagcttgccagcggtatgaagta
atgcagtgtttcacagtgtcacagccaaaatcaattcaagaagatggagaagatttccag
tcatgtttgatttgtattgcacggagattacctcggcctccagctattacgggtgtagaa
tcctttatgaccaagcaagatactacaggtaaaatcatctctattgatacgagttccctg
agagctgctggcagaactggctgggaagatttagtgagaaaatgcatttatgcttttttc
caacctcagggcagagaggcatcttatgccagacaactatttcaagaagtgatgactcgt
ggcactgcctccagcccatcctatagattcatattgaatgatgggacaatgcttagcgcc
cacaccaagtgtaaactttgctaccctcaaagtccagacatgcaacctttcatcatggga
attcatatcatcgacagggaacacagtggtctttctcctcaagatgacactaattctgga
atgtcaattccccgagtaaacccctccatcaatcctactatctctccagctcatggagtg
gcccgttcatcctcattgccaccatccaacagcaacatggtatccaccagagtcaaccgc
caacagagctcagaccttcatagcagcagccacagtaattctagcaacagccaagggagt
tttggatgctcacctggaagtcagattgtagccggtgttgccttaaaccagggtcaggcc
agttcccagagcactaatccctctttaaacctcaataattctcctatggaaggtacagga
gtgtccctcgcacagttcatgtctccaaggagacaagttagttctggactggcaacaagg
cccaggatgcctaacaattcctttccccctaatatcccaacattaagctcccctggtggc
atgacaagtactgcctgtaataatagtaaccgatcttattccaacatcccaggagcatcc
ttacagagtatgagtgaaggacccaataactctgttggcttctctgccagttctccagtc
ctcagacagataagctcacagaattcacctagcagattaaatatgcagccagcaaaagct
gagtccaaagataacaaagagattgcgtccattttaaatgaaatgattcagcctgacaac
agctctagtgatggcaaacctctggattctgggcttctgcataacaatgacagactgtca
gatggagacaacaaatactctcagaccagtcacaaactagtgcagcttttgacaacaact
gcagagcagcagttacggcatgctgatatagacacaagttgcaaagaggtactgtcttgc
actggcacttccaactctgccgctgctaactcttcaggcggctcttgcccctcctctcac
agctcactgacagaaaggcacaaaattctacaccggctcctgcaggaggggagcccctcg
gatctcaccaccttgtccgtcgagcctgataaaaaggacagtgcacctgcttctgtgtcg
gtgactggacaggcacaagggaactccataaaactagaaatggatgcttcaaagaaaaaa
gaatcaaaagaccaccaactcctacgctaccttttagacaaagatgagaaagatttaaga
tcaactccaaacctgagcctggatgatgtaaaggtgaaagtggaaaagaaagaacagatg
gacccttgtaacacaaacccaaccccaatgaccaaacctgcccctgaggaaatcaaactg
gagtcccagaaccagtttacagctgaccttgatcagtttgatcagttactacccacgttg
gagaaggcagccccattgccaggcttatgtgagaccgagaggatggatggtgcggtcagc
ggtgtcaccatcaaatccgagatcctgcccgcttcacttcaggccaccactgccagaccc
acttccaggctgaaccgattacctgagctggaattggaagcaattgataaccaatttgga
caaccaggaacaggtgatcagattccatggacaaatactacagtgacagctgtgaatcag
aacaaaccagaagaccagtgtattagttcacaattagatgagcttctctgtccaccaaca
acagtagaaggaagaaatgatgagaaagctctgcttgaacagctggtctctttcctcagt
ggcaaagatgaaactgagttggctgaattagatagagctctgggaattgacaaacttgtt
cagggaggtggactggatgtattatcagagagatttccaccacaacaagcaacaccacct
ttaatgatggaagaaagacccaacctttatccccagccttattcttctccttcacctact
gccagtctcactagccctttccaaggcatggtcaggcagaaaccttcattggggtccatg
cctgttcaagtaacacctccccgaggcgctttttcacctggcatgggcatgcagcccagg
caaactctaaacagacctccagctgcacccaatcaacttcgacttcaacttcaacagcga
ttgcaggggcaacagcagttgatacaccaaaatcggcaagctattttgaaccagtttgca
gcaaatgctccagttggcatcaatatgagatcaggcatgcagcagcaaattacacctcag
ccacccctgaatgcccaaatgttggcccagcgccagcgggaattgtacagccaacagcac
cgacagaggcagctaatacagcagcaaagagccatgctcatgaggcaacaaagctttggg
aacaacctccctcccgcatctggactgccagttcaaatggggaacccccgtcttcctcag
ggtgctccgcagcaattcccctacccaccaaactatggtacaaatccaggaaccccaccc
gcttctaccagcccgttttcacaactggcagtaaatcctgaggcaaccttggccaaccgc
aacagcatggtgaacagaggcatggcagggaacatgggaggacagtttggcacgggagtc
aatcctcagatgcagcagaatgtcttccagtatccaggatcaggaatggttccccaaggt
gaggccagctttgctccatctctgagccctgggagctccatggtgccgatgccaatccct
cctcctcagagctctctcctccagcaaactccacctgcttccgggtaccagtcaccagac
atgaaggcctggcagcaaggagcaatgggaaacaacaatgtattcagtcaagccgtccag
aaccagcccgcgcccgcacagccaggagtgtacaacaacatgagcatcactgtgtccatg
gcgggtggaaacaccaatgttcagaatatgaacccaatgatgggccagatgcagatgagc
tctttgcagatgccaggaatgaacactgtgtgccctgagcagatcagtgattcggcactg
agacacacaggcctctactgcaaccagctttcatcgactgaccttctcaaaacagaagca
gatggaacccagcaggtgcaacaggttcaggtgtttgctgacgtccagtgtacagtgaat
ctggtaggcggggacccttacctgaaccagcctggtccactgggaactcaaaaacccacg
gcaggaccacagaccccccaggcccagcagaagagcctccttcagcagctactgactgaa
taa

DBGET integrated database retrieval system