KEGG   Myotis brandtii (Brandt's bat): 102243368Help
Entry
102243368         CDS       T02920                                 

Gene name
GLS
Definition
(RefSeq) glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00220  Arginine biosynthesis
myb00250  Alanine, aspartate and glutamate metabolism
myb00471  D-Glutamine and D-glutamate metabolism
myb01100  Metabolic pathways
myb04724  Glutamatergic synapse
myb04727  GABAergic synapse
myb04964  Proximal tubule bicarbonate reclamation
myb05206  MicroRNAs in cancer
myb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102243368 (GLS)
   00220 Arginine biosynthesis
    102243368 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    102243368 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    102243368 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    102243368 (GLS)
   04727 GABAergic synapse
    102243368 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102243368 (GLS)
   05206 MicroRNAs in cancer
    102243368 (GLS)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     102243368 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 102243368
NCBI-ProteinID: XP_005872508
Position
Un
AA seq 491 aa AA seqDB search
MDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESA
KKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVN
DLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYV
MQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLC
SIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAK
KLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGH
VEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQGQYTPQGDADDGKEN
QTVHKNLDGLL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatatgttaagattaactcttcaaacaacatcagatggtgtcatgctagacaaagat
ctttttaaaaaatgtgttcagagcaacattgttttgttgacgcaagcctttagaagaaag
tttgtcattcctgactttatgtcttttacttctcatatcgatgagttatatgaaagcgct
aaaaagcagtctggaggaaaggttgcagactatattcctcaactagccaagttcagtcct
gatttgtggggtgtatcggtttgtacagtagatggacagaggcattctattggggatacc
aaagttccattttgtcttcagtcctgtgtgaaacctttgaaatatgccattgcggttaat
gaccttggaacagaatatgtgcatcgctatgttgggaaagagccaagtggattaagattc
aacaaactgtttttaaatgaagatgataagccacataatcctatggtaaatgctggagca
attgttgtgacttcattaataaagcaaggagtgaataatgctgaaaaatttgactatgtg
atgcagtttttgaataagatggctggtaatgaatatgttggattcagtaatgcaacgttt
cagtctgaaagagaaagtggagatcgaaattttgcaataggatattacttaaaagaaaaa
aagtgttttccagaaggcacagacatggttggtatattagacttctatttccagttatgc
tccattgaggtaacgtgtgaatcggccagtgtgatggctgcaacactggctaatggcggt
ttctgcccaattactggtgaaagagtactgagcccagaagccgtgcgaaacacgctgagt
ttgatgcattcctgtggcatgtatgacttctcagggcagtttgctttccatgttggtctt
cctgcaaaatccggagttgctgggggcattcttttagttgtcccaaacgtcatgggcatg
atgtgctggtcaccccctctggacaagatgggcaacagtgtgaagggaattcacttctgt
cacgatcttgtttctctgtgtaatttccataactatgataatttgagacactttgcaaaa
aaacttgatcctcgaagagaaggtggcgatcaaagggtgaagtcggtgataaacctcttg
tttgcggcctacacaggagacgtgtctgcacttcggagatttgccctgtcggccatggac
atggagcagcgggactatgactccagaacggccctccacgtggctgctgcagagggtcat
gttgaagtcgtgaaatttttgctggaagcctgcaaagtcaaccctttccccaaggacagg
tggaacaacacgcccatggacgaggcgctgcacttcggccaccacgacgtgttcaagatc
ctccaggagtaccagggccagtacacgccgcagggcgacgccgacgacgggaaggagaac
cagacggtgcacaagaacctcgacggcctcttgtaa

DBGET integrated database retrieval system