KEGG   Myotis brandtii (Brandt's bat): 102244256Help
Entry
102244256         CDS       T02920                                 

Gene name
ST6GAL1
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 1
Orthology
K00778  
beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 1) [EC:2.4.99.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:myb00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:myb00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 406 aa AA seqDB search
MIHTNLKKKFSCCVLVFLLFAVICMWKEKKKGSYDDSIKLQTKEFQMMRGLEKLALGSGS
QTALSSKTQDPHRGSQAVGSPKNPAKTKLETVFQVWNKDSSSKNIIPRLRKIWRNYLSMN
KYNVSYKGPGPGIKLSAEALRCHLRDQVNVSMVEATDFPFNTSEWEGFLPKENIRTKAGP
WGRCAVVSSAGSLKSSQLGKEIDDHDAVLRFNGAPTANFQQDVGMKTTIRLMNSQLVTTE
QNFLTDSLYNEGILIVWDPSIYHSDIPKWYKNPDYRFFDNYKSYRKLHPDQPFYILRPQM
PWELWDIIQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCHYYQKFF
DSACTMGAYHPLLFEKNMVKYLNQGVDEDIYLLGKATLPGFRSIHC
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgattcacaccaacttgaagaaaaaattcagctgctgtgtgctggtctttctcctgttt
gcagtcatctgtatgtggaaggagaagaagaaagggagttatgatgattccattaaattg
caaaccaaggaattccaaatgatgaggggcctggagaaacttgccctggggtctggttcc
cagactgcactttcaagcaaaacccaggacccccaccggggcagccaggccgttggcagt
cctaagaatccagccaagaccaagctagagaccgtcttccaggtgtggaacaaagacagc
tcttccaaaaacattatccccaggctgcggaagatctggaggaattatctgagcatgaac
aagtacaatgtgtcctacaagggaccagggcctggtatcaagctcagtgcagaggccctg
cgctgccaccttcgggaccaagtgaacgtatccatggtagaggccacagattttcccttc
aatacttctgaatgggagggtttcctgcccaaggagaacattaggaccaaggctgggcca
tggggcaggtgtgctgtcgtctcatcagcaggatctctgaagtcctctcaactgggcaaa
gaaatagatgatcatgatgcagtcctgaggtttaatggggcacctacagccaactttcaa
caggatgtgggcatgaaaaccaccattcgcctgatgaactctcagttggtcaccacagaa
cagaacttcctcacagacagtttgtacaatgagggaatcctgattgtgtgggacccgtct
atttaccattcagatatccccaagtggtacaagaatcccgactacagattctttgataac
tacaagagctatcgtaaactgcatcctgatcagcccttttacatcctcagaccccagatg
ccctgggagctgtgggacatcattcaagaaatctccccagaggagattcagccaaatccc
ccgtcctctgggatgctcggcatcatcatcatgatgacgctgtgtgaccaggtggatatt
tacgagttcctgccatccaagcgcaagactgacgtgtgccactactaccagaagttcttc
gacagcgcctgcaccatgggtgcctaccacccgctcctctttgagaagaatatggtgaag
tacctcaaccagggcgtggacgaggacatttacctgcttggaaaagccacactgcctggc
ttccggagcattcactgctga

DBGET integrated database retrieval system