KEGG   Myotis brandtii (Brandt's bat): 102244854Help
Entry
102244854         CDS       T02920                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:myb00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 357 aa AA seqDB search
MASKSWLNFLIFLCRSAVGFVLCSQLFSILLGEQGDTQPKILHNDPHARHSDDNGQNHLE
GQMNFNADVSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLETREGRDQLCWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKHSPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTEKCTHSSSIED
LALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPENIRKEISQAYKNEDPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaatcttcctctgtagatcagcagttggattt
gttttatgttctcagctatttagtattttgttgggagaacagggtgacacccaacccaag
attcttcataatgatcctcatgctaggcattcagatgataatggacagaatcatctagaa
ggacagatgaacttcaatgcagatgttagccaacataaagatgagaacactgacatcgct
gaaaacctctatcagaaggttaaaattctttgctgggttatgacaggacctcaaaatcta
gagaaaaaggctaaacatgtcaaagctacatgggcccagcgctgtaataaagtgttgttt
atgagttcagaagaaaacaaagacttccctgctgtgggattagaaaccagagaaggcaga
gaccagctatgctggaaaacaattaaagcttttcagtatgttcatgatcactatctagaa
gatgctgattggtttatgaaagccgatgacgatacatatgttatactagacaatttgaga
tggcttctctcaaaacacagccctgaagaacccatttactttgggagaagatttaagccc
tatgttaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagccttg
aagagatttgttgatgcgtttaaaacagagaaatgtacacatagttcctccattgaagat
ttagcactgggaagatgcatggaaattataaatgtagaagcgggagattccagagatacc
attggaaaagaaacttttcatccctttgtaccagagcaccacttaatcaagggttattta
cctaaaacattttggtattggaattataactattaccctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaaccatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggatatttatacagatatcaacctgccttacct
gaaaatatacggaaggaaataagtcaagcatacaaaaatgaagatccaaagtaa

DBGET integrated database retrieval system