KEGG   Myotis brandtii (Brandt's bat): 102244854Help
Entry
102244854         CDS       T02920                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102244854
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     102244854
Glycosyltransferases [BR:myb01003]
 Glycan extension
  Type 3 chain
   102244854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 357 aa AA seqDB search
MASKSWLNFLIFLCRSAVGFVLCSQLFSILLGEQGDTQPKILHNDPHARHSDDNGQNHLE
GQMNFNADVSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLETREGRDQLCWKTIKAFQYVHDHYLEDADWFMKADDDTYVILDNLR
WLLSKHSPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTEKCTHSSSIED
LALGRCMEIINVEAGDSRDTIGKETFHPFVPEHHLIKGYLPKTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDPTTMYELEYLVYHLRPYGYLYRYQPALPENIRKEISQAYKNEDPK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcctctaaatcttggctgaattttttaatcttcctctgtagatcagcagttggattt
gttttatgttctcagctatttagtattttgttgggagaacagggtgacacccaacccaag
attcttcataatgatcctcatgctaggcattcagatgataatggacagaatcatctagaa
ggacagatgaacttcaatgcagatgttagccaacataaagatgagaacactgacatcgct
gaaaacctctatcagaaggttaaaattctttgctgggttatgacaggacctcaaaatcta
gagaaaaaggctaaacatgtcaaagctacatgggcccagcgctgtaataaagtgttgttt
atgagttcagaagaaaacaaagacttccctgctgtgggattagaaaccagagaaggcaga
gaccagctatgctggaaaacaattaaagcttttcagtatgttcatgatcactatctagaa
gatgctgattggtttatgaaagccgatgacgatacatatgttatactagacaatttgaga
tggcttctctcaaaacacagccctgaagaacccatttactttgggagaagatttaagccc
tatgttaagcagggctacatgagtggaggagcaggatatgtactgagcaaagaagccttg
aagagatttgttgatgcgtttaaaacagagaaatgtacacatagttcctccattgaagat
ttagcactgggaagatgcatggaaattataaatgtagaagcgggagattccagagatacc
attggaaaagaaacttttcatccctttgtaccagagcaccacttaatcaagggttattta
cctaaaacattttggtattggaattataactattaccctcctgtagagggtcctggttgc
tgttctgatcttgcagtttcttttcactatgttgatcctacaaccatgtatgagttagaa
tacctcgtttatcatcttcgtccatatggatatttatacagatatcaacctgccttacct
gaaaatatacggaaggaaataagtcaagcatacaaaaatgaagatccaaagtaa

DBGET integrated database retrieval system