KEGG   Myotis brandtii (Brandt's bat): 102244974Help
Entry
102244974         CDS       T02920                                 

Gene name
SIRT6
Definition
sirtuin 6
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102244974 (SIRT6)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102244974 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 351 aa AA seqDB search
LGLGIEPATKIFDPPEELERKVWELAKLVWQSSHVVFHTGAGISTASGIPDFRGPHGVWT
MEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAEL
HGNMFVEECVKCKRQYVRDTVVGTMGLKATGRLCTMAKARGLRACRGKLRDTILDWEDAL
PKRDLTLADEASRIADLSVTLGTSLQIGPSGNLPLATKRRGGRLVIVNLQPTKHDRQADL
RIHGYVDEVMTQLMKHLGLEIPAWDGPRVVERALTPGPGDPCLGRAPRGGEGADAXXXXD
GPAPASPKRESTTEPPAQHNGSGPVSPKREQLDSPVPRRTPKRVKTELLPS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ctggggttggggatcgagcctgcaaccaagatcttcgacccccctgaggagttggagcgg
aaggtgtgggagctggcaaagctggtttggcagtcttcccatgtggtgttccacacgggc
gctggcatcagcaccgcctcgggcatccctgacttcagaggcccccatggcgtctggacg
atggaggagcggggcctggctcccaagttcgacaccaccttcgagagcgcacggcccaca
cagacccacatggcgctggtgcagctggagcgcgtgggccttctccgcttcctggtcagc
cagaacgtggatgggctgcacgtgcgctctggctttcctagggacaagctggcagagctt
catgggaacatgtttgtagaagaatgtgtcaagtgtaaaaggcaatatgtccgggacact
gtggtgggcaccatgggcctcaaagccactggccggctctgcaccatggccaaggcaagg
ggcctgcgggcctgcagggggaagctgagagacaccatcctggactgggaggatgctctg
cccaaacgggacctcactcttgctgatgaagccagcaggatcgcggacctgtctgtcaca
ctaggcacctccctccaaatcgggcccagcgggaacctgccgctggccaccaagcgccgt
ggaggcaggctggtcatcgtcaacctccagcccaccaagcacgaccgccaggctgacctc
cgcatccacggctacgtagacgaggtcatgacccagctcatgaaacacctgggcctggag
atccccgcctgggacgggccccgcgtggtggagagggcgctaacacctgggcctggagat
ccctgcctgggacgggccccgcgtggtggagagggcgctgacgcnnnnnnnnnnnttgac
ggtccagcaccggccagccccaagcgagagtccacaaccgaaccccctgctcagcacaat
ggttccgggcccgtcagccccaagagggagcagctggacagtcctgtcccccgcaggacc
cctaaaagggtgaagaccgagctgcttcccagctga

DBGET integrated database retrieval system