KEGG   Myotis brandtii (Brandt's bat): 102244974Help
Entry
102244974         CDS       T02920                                 

Gene name
SIRT6
Definition
(RefSeq) sirtuin 6
  KO
K11416  mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb04714  Thermogenesis
myb05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:myb00001]
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    102244974 (SIRT6)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    102244974 (SIRT6)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102244974 (SIRT6)
Chromosome and associated proteins [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     102244974 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 102244974
NCBI-ProteinID: XP_014389174
Position
Un
AA seq 281 aa AA seqDB search
LGLGIEPATKIFDPPEELERKVWELAKLVWQSSHVVFHTGAGISTASGIPDFRGPHGVWT
MEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAEL
HGNMFVEECVKCKRQYVRDTVVGTMGLKATGRLCTMAKARGLRACRGKLRDTILDWEDAL
PKRDLTLADEASRIADLSVTLGTSLQIGPSGNLPLATKRRGGRLVIVNLQPTKHDRQADL
RIHGYVDEVMTQLMKHLGLEIPAWDGPRVVERALTLASTAT
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
ctggggttggggatcgagcctgcaaccaagatcttcgacccccctgaggagttggagcgg
aaggtgtgggagctggcaaagctggtttggcagtcttcccatgtggtgttccacacgggc
gctggcatcagcaccgcctcgggcatccctgacttcagaggcccccatggcgtctggacg
atggaggagcggggcctggctcccaagttcgacaccaccttcgagagcgcacggcccaca
cagacccacatggcgctggtgcagctggagcgcgtgggccttctccgcttcctggtcagc
cagaacgtggatgggctgcacgtgcgctctggctttcctagggacaagctggcagagctt
catgggaacatgtttgtagaagaatgtgtcaagtgtaaaaggcaatatgtccgggacact
gtggtgggcaccatgggcctcaaagccactggccggctctgcaccatggccaaggcaagg
ggcctgcgggcctgcagggggaagctgagagacaccatcctggactgggaggatgctctg
cccaaacgggacctcactcttgctgatgaagccagcaggatcgcggacctgtctgtcaca
ctaggcacctccctccaaatcgggcccagcgggaacctgccgctggccaccaagcgccgt
ggaggcaggctggtcatcgtcaacctccagcccaccaagcacgaccgccaggctgacctc
cgcatccacggctacgtagacgaggtcatgacccagctcatgaaacacctgggcctggag
atccccgcctgggacgggccccgcgtggtggagagggcgctgacgctcgcatccacggct
acgtag

DBGET integrated database retrieval system