KEGG   Myotis brandtii (Brandt's bat): 102245848Help
Entry
102245848         CDS       T02920                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    102245848
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    102245848
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     102245848
Protein kinases [BR:myb01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   102245848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 88 aa AA seqDB search
MCVVELKDRPGSPLFHLEHYIEGKYTKYNSNSGFVRDDARLTPQAFSHFTFERSGHQLIV
VDIQGVGDLYTDPQIHTEKGTDFGDGNL
NT seq 265 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgtggtggagctgaaggacaggccgggctcgcccctcttccacctagaacactac
atcgagggcaagtacaccaagtacaactccaactcgggcttcgtccgtgatgacgcgcgc
ctgacgcctcaggccttcagccacttcacctttgagcgttccggccaccagctgatcgtg
gtggacatccagggtgtgggcgacctctacaccgacccacagatccacaccgagaagggc
actgactttggagatggcaacctag

DBGET integrated database retrieval system