KEGG   Myotis brandtii (Brandt's bat): 102246125Help
Entry
102246125         CDS       T02920                                 

Gene name
ART4
Definition
ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102246125 (ART4)
Cellular antigens [BR:myb04090]
 Proteins
  102246125 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 322 aa AA seqDB search
MKLQDGRSTFNSNKCCPLTNRRRKILLPITTAPATGIWLLRAQLPLLLLFAGLQRPTAAI
KINFDLAPDSFDDQYKGCSQQVMKELSQGDYVAKEVEAQTNYYKIWNNAHLTWLNRAKAL
PKNMTITHAVAILVYTLNNNVRSDFTRAMASAARSPWQYKHSFHFKYLHYYLTSAIQLLR
KGLVMKNDSLCYQVYHETDFYLKAYIGATLRFGQFLPTSLLRKEAQESGNQTLFTILTCL
GAPVQDFSLREEVLVPPYELFEVVNMSYHPRGNWLQLRSTGNLSTYNCQLLKASSKKCIP
APVVIAALSFLTIVTISLKSGV
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaagctacaagatggaagaagtacatttaactcaaacaaatgctgtcccttgaccaac
agacgcaggaagattttactcccaataactacagctcctgcgacaggaatctggctcctc
cgagcacagcttcctctcctgctgctgtttgctggcctgcagagacccacggctgcaatt
aaaatcaactttgacttggcaccagattcctttgacgatcaatacaaaggctgcagccaa
caggtcatgaaggagctaagtcaaggggattatgtcgcaaaagaagtagaagcccagaca
aattattacaagatctggaataatgcccatttaacctggctgaaccgagctaaagctctc
cctaagaacatgacaatcacacatgctgtggccatcttggtgtacacattgaacaacaat
gttcgctctgacttcactagagccatggccagtgctgccaggtctccatggcagtataaa
cattcattccatttcaaatacctacattactacctgacctcagcaatccagctgctgagg
aaagggcttgtcatgaagaatgactctctgtgctaccaggtgtatcatgagaccgatttc
tacttgaaagcctacataggtgccacccttcgatttggccaattcctgcccacctccctc
ctaagaaaagaggcacaggagtctgggaaccaaactctatttaccatacttacctgcctg
ggtgcacctgtacaagacttctctctcagggaggaggttctggtccctccctatgagttg
tttgaagttgtaaatatgagctaccacccaagaggaaattggttgcaattgagatcaact
ggaaatctgagcacatataactgtcagctgctaaaagcttccagcaaaaagtgcatccct
gctcctgtagttattgctgctctctcctttttgaccattgtcaccatctctttaaaaagt
ggagtatag

DBGET integrated database retrieval system