KEGG   Myotis brandtii (Brandt's bat): 102246127Help
Entry
102246127         CDS       T02920                                 

Gene name
ALDH1L1
Definition
aldehyde dehydrogenase 1 family, member L1
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    102246127 (ALDH1L1)
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     102246127 (ALDH1L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 902 aa AA seqDB search
MKIAVIGQSLFGQEVYCHLRKEGYEVVGVFTVPDKNGKADPLGLEAEKDGVPVFKFPRWR
EKGQALPDVVAKYQALGAELNVLPFCSQFIPMEVINAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTVFWADDGLDTGDLLLQRECEILPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGRAPRVPQPEEGATYEGIQKKETAKINWEQPAEAIHNWIRGNDKVPGAWTEACGQ
KLTFFNSTLNTAGLVPEGEALPIPGAHRPGVVTKAGLILFGNDDRMLLVKNIQLEDGKMI
PASHFFRGEDSSALELTEAELVTMEGVRSAWKRILPNVLEVEDSTDFFKSGAASVDVVRL
VEEVKELCDGVELENEDVYMATTFKDFIQLLVRKLRGDDKESECIIDYVEKAVNKLTLRM
PHQLFIGGTFVDAEGAKTYETINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGLWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTRKEPIGVCGIVIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIIFADCDLSKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVQKVVEEVKKMKIGNPLDRDTNHGPQNHQAHLRKLIEYCQRGVKEGATLVCGGNQVP
RPGFFFEPTVFTDVEDHMFIAKEESFGPVMVISRFADGDMDTVLSRANATEFGLASGVFT
RDIGKALYVSDKLEAGTVFINTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTF
EY
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgcagtgatcgggcagagcctgtttggccaggaagtttattgccacctgagg
aaggaaggctatgaggtcgtaggcgtgttcactgtcccagacaagaatgggaaggcggac
cccctgggcctggaggctgagaaggatggagtgccagtgtttaagttcccccgctggcgg
gagaaaggacaggctctgcctgacgtggtggcaaaataccaggctctgggtgctgagctc
aacgtcctgcccttctgcagccagttcatccccatggaggtcatcaatgccccccgccat
ggctccatcatctaccacccgagtctgctcccccggcatcgaggggcctcggccatcaac
tggaccctcattcacggcgataaaaaaggggggtttaccgtcttctgggcagatgacggc
ctggacaccggggaccttctgctccagcgggagtgtgagatcctcccggacgacaccgtg
agcactctgtataaccgcttcctcttccctgaaggcatcaaagggatggtgcaggctgtg
agactgattgccgagggcagagcccccagagtccctcagcctgaggaaggagccacctac
gaaggcatccagaagaaggaaacagccaagatcaactgggagcagccagcagaggccatt
cataactggatccgtgggaacgacaaggtgccgggcgcctggacagaggcttgtgggcag
aagctgacgtttttcaactccacgctgaacactgcaggcctggtgcctgagggagaagct
ttgcccatcccgggagcccaccggccgggggtggtcaccaaagcgggactgatcctcttc
gggaatgatgacagaatgctgctggtgaagaacatccagctggaggatggcaagatgatc
ccggcctcgcacttcttcaggggagaagacagcagcgccctcgagctgacggaggcagaa
ctggtcaccatggagggtgtgcggagtgcctggaagcggattctccccaacgtcctggag
gtagaagactccaccgatttcttcaagtcgggtgccgcatcagtggatgtggtgagattg
gtggaggaagtgaaagagctgtgtgatggtgtggaactggaaaatgaagatgtttacatg
gcaaccactttcaaggacttcatccagctgttagtgagaaagctgcgaggggatgacaaa
gagagcgagtgcatcattgactacgtggaaaaggcagtgaacaagctgaccctccgaatg
ccccaccagctcttcattgggggcacatttgtggatgccgagggtgccaagacctatgag
accatcaacccgacagatggaagtgttatctgccaggtgtccctggcccaggtcagcgat
gttgacaaggcagtggctgctgcaaaagatgcctttgagaatggattgtgggggaagatc
agtgcccgggaccggggccggctcctgtacaggttggcagacctcatggagcagcatcag
gaagagctggccaccattgaggctctggatgcaggcgctgtctacaccctggccctgaag
acccacgtgggcatgtccatccagaccttccgctactttgctggctggtgtgacaagatc
cagggctccaccatccccatcaaccaggccagacccaacagaaacctgactttgaccagg
aaggagccaattggggtctgtggcattgtcatcccctggaactaccccctgatgatgctt
tcctggaagacggccgcctgcctggctgctgggaacacagtggtgatcaagcctgcccag
gtgaccccgctcacagccttgaagtttgcagagctgaccttgaaggctggcattcccaag
ggcgtgatcaacatcctcccaggatctggctcattggttggccagagactctcagaccat
cctgatgtgcgaaaaattgggttcacaggctccacagaggtgggaaagcacatcatgaaa
agctgtgccctgagcaacgtgaagaaggtgtccctggagctcggtgggaagtcacccctc
atcatctttgctgactgtgacctcagcaaggctgtgcagatggggatgagctccgtcttc
ttcaacaaaggcgagaactgcattgccgcgggccggctcttcgtagaggactcaatacac
gaccagtttgtgcagaaggtggtagaagaggtgaagaagatgaagattggcaaccctcta
gaccgggacaccaaccatgggccgcagaatcaccaggcccacctccggaagctgatagag
tactgccagcgcggcgtgaaggaaggggccactctggtctgcggtgggaatcaagttcct
cggccaggtttctttttcgagccaaccgttttcacggacgtggaggaccacatgttcata
gccaaggaagagtccttcgggcctgtcatggtcatctctcggtttgccgatggcgacatg
gacactgtgctgtctcgggccaatgccacagaatttggcctggcctctggcgtcttcacc
agggacatcggcaaggccctgtacgtcagtgacaagctggaggcaggcaccgtgttcatc
aacacgtacaacaagaccgacgtggccgctcccttcggaggcttcaagcagtctggattt
ggcaaagacttgggagaggcggccctgaatgagtacctgagggtcaagacggttaccttt
gagtactga

DBGET integrated database retrieval system