KEGG   Myotis brandtii (Brandt's bat): 102246159Help
Entry
102246159         CDS       T02920                                 

Gene name
RNASE2
Definition
(RefSeq) ribonuclease, RNase A family, 2 (liver, eosinophil-derived neurotoxin)
Organism
myb  Myotis brandtii (Brandt's bat)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 149 aa AA seqDB search
MVPTQRDSQLCLLLLLGLMGMVISFHAPPRGLTWAQWFEVQHVNMTNAQCTIAMQRINRL
RRPCKGQNTFIHTSLAAVVNLCYTANITCRNGVDKNCYRSRVAVHLTYCNLTRPAHPYYR
CQYQQVALLRNYSVACDNGHIPVHFDRII
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atggttccaacacagcgggattcccagctttgtctccttctgctgctggggctcatggga
atggtgatctccttccatgccccacctaggggtctaacctgggctcagtggtttgaagtt
caacacgtaaacatgaccaatgctcaatgcaccattgcaatgcagcggattaaccgttta
cggaggccatgcaaaggccaaaatactttcatccacacatcgcttgctgctgttgttaat
ctctgttacacagcaaatataacctgccgtaatggggttgataaaaattgctatagaagc
cgagttgcagtgcatcttacctactgcaacctcaccagaccggcacatccttactatcgg
tgccaataccagcaagtagccttactgagaaactacagtgttgcctgtgacaatggacac
attccagttcatttcgatagaatcatctaa

DBGET integrated database retrieval system