KEGG   Myotis brandtii (Brandt's bat): 102246496Help
Entry
102246496         CDS       T02920                                 

Gene name
POR
Definition
P450 (cytochrome) oxidoreductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     102246496 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MFVINMGDSNTDTSATGSETVAEEVSLFSMTDMILFSLIVGLLTYWFFFRKKKDEIPEFT
KIQAMTSSVKDSSFVEKMKKTGRNVIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPE
EYDLADLGSLPEIENSLAVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKYAVFGLGN
KTYEHFNAMGKYVDKRLEQLGAQRIFELGMGDDDGNLEEDFITWREQFWPAVCEHFGVEA
TGEESSIRQYELVVHTDIDMAKVYVGEMGRLKSYENQKPPFDAKNPFLAVVTTNRKLNQG
TERHLMHLELDISDSKIRYESGDHVAIYPANDSALVNQIGEILGADLDVVMSLNNLDEES
NKKHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASEPSEQEHLRKMASSSGEGKEL
YLSWVVEARRHILAILQDYPSLRPPIDHLCELLPRLQARYYSIASSSKVHANSVHICAVV
VEYETKSGRINKGVATSWLRAKEPAGENGCRALVPMFVRKSQFRLPFKATTPVIMVGPGT
GVAPFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELAQFHKEGSLTQLNVAF
SREQPQKVYVQHLLKRDKEHLWKLIHEGGAHIYVCGDARNMARDVQNTFYDIVSELGSME
HTQAVDYIKKLMTKGRYSLDVWS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgttcgtgatcaacatgggggactccaacacagataccagcgccaccgggtctgagact
gtggctgaggaagtctctcttttcagcatgacggacatgattctgttttcactcattgtg
ggtctcctgacctactggttcttcttcagaaagaaaaaagacgaaatccctgagttcacc
aaaattcaagcaatgacctcctctgtcaaagacagcagcttcgtggaaaagatgaagaag
acgggcaggaacgtcatcgtgttctatggctcccagacggggactgccgaggagtttgcc
aaccgcttgtccaaggacgcccaccgctacggcatgcggggcatgtcagcagaccccgag
gagtatgacttggccgacctgggcagcctgccagaaatagagaactccctggcagtgttc
tgtatggccacctacggcgagggtgaccccactgacaatgctcaggacttctatgactgg
ctccaggagacagatgtggacctctctggagtcaagtatgcggtgtttggccttgggaac
aagacctatgagcacttcaatgccatgggaaagtatgtggataagcggctagagcagctt
ggtgcccagcggatctttgagctggggatgggcgacgatgacgggaacctggaggaggat
ttcatcacatggcgagagcagttttggccggctgtgtgtgagcactttggggtggaagcc
actggagaggagtccagcattcgccagtatgagcttgtggttcacacagacatagacatg
gccaaggtgtacgtgggtgagatgggacgtctgaagagctacgagaaccagaaacccccc
tttgatgccaagaatccattcttggctgtcgtcaccaccaaccggaagctgaaccaggga
actgagcgacacctcatgcatctggaattagacatctcagattccaaaatcaggtatgaa
tcgggtgaccatgtagctatttacccagccaatgactctgccctggtcaaccagattggc
gagatcctgggtgctgacctggatgttgtcatgtccctgaacaatcttgatgaggaatcc
aacaagaagcatccattcccctgccccacctcctaccgcacagccctcacctactacctg
gacatcaccaacccgccacgcaccaatgtgctctacgagctggcccagtacgcctccgag
ccctcggagcaggaacacctgcgcaagatggcctcttcctcgggcgagggcaaggagctg
tacctgagctgggtggtggaggctcggaggcacatcctggccatcctgcaggactaccca
tccctgcggccccccatcgaccacctgtgtgagctgctgcctcggctgcaggcccgctac
tactccatcgcttcttcctctaaggtccacgccaactctgtgcacatctgtgctgtggtt
gtggaatatgaaaccaagtctggccgaatcaacaagggtgtagccaccagctggcttcga
gccaaggagcccgcaggggagaatggctgcagggccctggtgcccatgtttgtgcgcaag
tcccagttccgcctgcccttcaaggccaccacacctgtcatcatggtgggccctggcact
ggggttgcccccttcataggcttcattcaggagcgggcctggctgcggcagcagggtaag
gaggtgggtgagacgctgctctactatggctgccgccgctctgacgaggactacctgtac
cgtgaagagctggcccagttccacaaggagggctccctcacccagctcaatgtggcattc
tcccgggaacagcctcagaaggtctacgtccagcacttactgaagagagacaaggagcac
ctgtggaagctgatccacgaggggggcgcccacatctatgtctgtggggatgctcggaac
atggcgagggatgtgcagaacaccttctacgacattgtgtctgagctggggtccatggaa
cacacccaggccgtggactacatcaagaaactgatgaccaagggccgatactccctggat
gtgtggagctaa

DBGET integrated database retrieval system