KEGG   Myotis brandtii (Brandt's bat): 102246722Help
Entry
102246722         CDS       T02920                                 

Definition
chymotrypsinogen 2-like
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     102246722
Peptidases [BR:myb01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102246722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 263 aa AA seqDB search
MAFLWLLSCFALLGTAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSHLVVAGEFDQGSDAEDTQVLKIAKVFKNPKFNMFTVNND
ITLLKLATPARFSQTVSAVCLPDEADDFPAGTLCATTGWGLTKHNNANTPDKLQQAALPL
LSNASCKKFWGNKITDLMVCAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSGTCST
SSPGVYARVTELMPWVRQILADN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggccttcctctggctcctctcttgcttcgccctcctgggcacagccttcggctgcgga
gtccccgccatccaccccgtgctgagcggcctgtccaggatcgtcaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgc
gggggctccctcatcagcgaggactgggtggtgactgctgcccactgtggggtcagaacc
tcccacctggttgtggctggggagtttgaccagggctcagacgctgaggacacccaggtg
ctgaagattgccaaggtgttcaagaaccccaagttcaacatgttcaccgtcaacaacgac
atcaccctgctgaagctggccacgcccgcccgcttctctcagaccgtgtctgccgtgtgc
ctgcccgatgaggccgacgacttccccgccggcaccctgtgcgccaccaccggctggggc
ctgaccaaacacaacaatgccaacacccccgacaagctgcagcaggcggccctgcccctc
ctgtccaacgccagctgcaagaagttctggggcaacaagatcaccgacctcatggtctgc
gccggcgccagcggcgtctcctcctgcatgggcgactctgggggccccctggtctgccag
aaggatggagcctggaccctggtgggcatcgtgtcctggggcagcggcacctgctccacc
tccagccctggcgtgtacgcccgggtcacggagctcatgccctgggtgcggcagatcctg
gccgacaactga

DBGET integrated database retrieval system