KEGG   Myotis brandtii (Brandt's bat): 102247220Help
Entry
102247220         CDS       T02920                                 

Gene name
GTF3C4
Definition
general transcription factor IIIC, polypeptide 4, 90kDa
Orthology
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102247220 (GTF3C4)
Transcription machinery [BR:myb03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     102247220 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 676 aa AA seqDB search
MLDRAFNPEGKALPPLRGFKYTTWSPMGCDANGRCLLAALTLDNRLTIQANLNRLQWVQL
VDLTEIYGDRLFETSYRFSKTEAPGGNLADFAEFQRRHSMQTPVRMEWSGICTTQQVTHN
NECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESISSCNTIESGISSPSVLFWWEYEHNN
RKMSGLIVGSAFGPVKILPVNLKAIKGYFTLRQPIVLWKEMDQLPVHSIKCVPLYHPYQK
CNCSLVVAARGPYVFWCLLLISKAGLNVHNSHVTGLHSMPIVSMTADKQNGTVYTCSSDG
KVRQLIPIFTDVALKFEHQLIKLSEVFGSVRTHGIAVSPCGAYLAIITTEGMINGLHPVN
KNYQVQFVALKTFEEAAAQLLESSVQNLFKQVDLLDLVRWKILKDKYIPPFLQEALEKKI
ESSGATYFWRFKLFLLRILYQSMQKTPSEALWQPTKEDSKVLLVDSPGMGPMEDEQEEGT
SSRQASKQGLQEKSKEGDPDDPADDSLTQAGDVGGHEPMEEKLLEIQGKIEAVEMHLSRE
HMKRVLGEVYLHTWITENTSVPTRGLCDFLMSDEEYDDRTARVLIGHISKKMNKQTFPEH
CSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWI
KRLLQSPCPFCDSPVF
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgttggacagggcgttcaaccctgaggggaaggctttgcccccactgagagggtttaag
tacaccacctggtcccccatgggctgcgatgctaatggcaggtgcctcttggcagctctg
accctggacaatcgcctgaccatccaggctaacctcaacaggctgcagtgggtccagctg
gtcgacctgactgagatttacggagaccgtctctttgagaccagttacaggttctctaaa
accgaggcccccggagggaacctggcggactttgctgagttccagaggagacacagcatg
cagacgccagtgaggatggagtggtcgggcatctgcaccacgcagcaggtcacgcacaac
aatgagtgccgggacgtgggcagcgtgctcctggccgtcctctttgaaaacggcaacatc
gctgtgtggcagttccagctgcctttcgtggggaaggagtccatctcttcctgcaacaca
atcgagtcgggaatcagctctccaagtgtcttgttttggtgggaatatgagcacaataat
cggaaaatgagtggccttattgtggggagtgccttcggacccgtaaaaatcctccctgtc
aatctcaaagccattaaaggctatttcacgctaaggcagcccattgtcctgtggaaagaa
atggaccagttgcccgtgcacagcatcaagtgtgtgccgctctatcacccttaccagaag
tgtaactgcagcttggtggtggccgccagaggaccctatgtgttctggtgtctcctgttg
atctccaaggcaggtctgaatgttcacaattcccacgtcacgggccttcactcgatgccc
atcgtttccatgacggcagacaagcagaacgggaccgtatacacttgctccagcgacggc
aaggtgaggcagctgattcccatcttcactgatgtcgccttgaagtttgaacaccagctg
attaagctgtcagaggtgtttggctcagtgaggacacacgggatagcggtgagcccctgc
ggtgcgtatctggccatcattacaactgagggcatgatcaatggcctccatcccgttaac
aaaaactaccaggtccagtttgttgctctcaaaacttttgaagaggcagctgctcagctc
ttggaatcttcggttcagaacctctttaaacaggtagatttgctagacctcgtgcgctgg
aagattctgaaagataaatatatccctccgtttttacaagaagctttggaaaagaagatc
gaaagcagcggggccacctacttttggcgtttcaagctttttctcctgaggattttgtat
cagtcgatgcagaaaaccccttccgaagctttgtggcagcccaccaaggaggactcgaaa
gtcttgctagtcgactcccctgggatgggccccatggaggacgagcaagaagaaggcacg
tcctccagacaggcgagtaagcaaggccttcaggagaagagcaaagagggggacccggac
gaccccgccgatgactccctcacccaggcgggagatgtcggaggccatgagccgatggag
gagaaactgctggaaatccaggggaagatcgaagctgtggaaatgcacttgagcagggag
cacatgaagcgggtcttgggagaagtgtacctgcacacgtggatcacggagaacaccagc
gtccccaccagggggctctgcgacttcctcatgtctgacgaggagtatgacgaccggaca
gcgcgggtgctgattggccacatctccaagaagatgaacaagcagaccttccctgagcac
tgcagtctgtgcaaggagatcttgcctttcacggaccgcaagcaggcggtctgctccaac
ggccacatctggctccggtgctttttaacctaccagtcctgccagagcctgatctacaga
aggtgtttgctccacgatagtattgcccgccacccggctccggaagaccccgactggatc
aagaggctgctgcaaagcccctgccctttctgcgactctcctgtcttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system