KEGG   Myotis brandtii (Brandt's bat): 102247387Help
Entry
102247387         CDS       T02920                                 

Gene name
LPL
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00561  Glycerolipid metabolism
myb01100  Metabolic pathways
myb03320  PPAR signaling pathway
myb04979  Cholesterol metabolism
myb05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    102247387 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    102247387 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    102247387 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    102247387 (LPL)
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     102247387 (LPL)
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   102247387 (LPL)
  Exosomal proteins of breast milk
   102247387 (LPL)
Glycosaminoglycan binding proteins [BR:myb00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   102247387 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:myb00537]
 Enzymes
  102247387 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1
Motif
Other DBs
NCBI-GeneID: 102247387
NCBI-ProteinID: XP_005873861
Position
Un
AA seq 476 aa AA seqDB search
MESKALLLVALGVWLQSLTASRGGVAADNIGERDFTDIESKFALRTPEDTAEDTCHIIPG
VTESVANCHFNHSSKTFVVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLWRAQQ
HYPVSAGYTKLVGKDVATFINWMAEEFNYPLDNVHLLGYSLGAHAAGVAGSLTNKKVNRI
TGLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTF
QPGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCNSKEAFEK
GLCLSCRKNRCNNVGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGAESDTQTN
QAFEISLYGTVAESEHIPFTLPEISTNKTYSFLIYTEVDIGELLMLKLKWNSDSYFSWSD
WWSSPGFAIEKIRVKAGETQKKVIFCSREKVSRLQKGKSSVVFVKCHDKSLTKKSN
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagcgctgctcctggtggctctgggcgtctggctccagagtctgaccgcc
tcccgcggaggggtggccgccgacaatataggagaaagagattttacagacattgagagt
aaatttgctctaaggacccctgaagacacagctgaggacacttgccacatcattcctgga
gtgacagagtctgtggctaactgccacttcaaccacagcagcaaaaccttcgtggtgatc
catggctggacggtgacgggaatgtatgagagctgggtgcccaaactcgtggctgccctg
tacaagagggagccggactccaacgtcatcgtggtggactggctgtggcgggcccagcag
cactacccagtgtctgcgggctacaccaagctggtggggaaggatgtggccacgtttatc
aactggatggcggaggaatttaactaccctctggataatgtccatctcttgggatacagc
ctgggggcccacgctgctggcgttgcaggaagtctgaccaataagaaggtcaacagaatt
acgggcctagatccagccggacctaactttgaatacgcagaagctccaagtcgcctttct
cccgatgatgcggattttgtagacgtcttacacacattcaccagagggtcacctggccga
agtattggaatccagaaaccagtagggcatgttgacatttacccgaatggaggcacgttt
caaccaggctgtaacattggggaagctatccgtgtgattgcagagagaggccttggagat
gtggatcagctggtgaagtgttcccacgaacgctccattcatctcttcattgactctctg
ctgaatgaggaaaaccccagtaaggcctaccggtgcaattcaaaggaagcctttgagaaa
gggctctgcctgagttgcagaaagaaccgttgcaacaacgtgggctatgagatcaacaag
gtcagagccaagagaagcagcaaaatgtacctgaagactcgttctcaaatgccttacaaa
gtcttccattaccaagtaaagatacatttttctggagctgagagtgacacacagaccaac
caggccttcgagatctctctgtacggcaccgtggccgagagtgagcacatccccttcacc
ctgcctgaaatttccacgaataagacgtactctttcctcatttacacggaggtggacatc
ggagaactgctgatgttgaagctcaaatggaatagcgactcatacttcagctggtccgac
tggtggagcagccctggctttgccattgagaagatcagagtgaaagcaggagagactcaa
aagaaggtgatcttctgttccagggagaaagtgtctcgtctgcagaaaggaaagtcatct
gtggtatttgtgaaatgccacgacaagtctctgactaaaaagtctaactga

DBGET integrated database retrieval system