KEGG   Myotis brandtii (Brandt's bat): 102247419Help
Entry
102247419         CDS       T02920                                 

Gene name
JOSD2
Definition
(RefSeq) Josephin domain containing 2
  KO
K15235  
josephin [EC:3.4.19.12]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102247419 (JOSD2)
Peptidases [BR:myb01002]
 Cysteine Peptidases
  Family C86
   102247419 (JOSD2)
Ubiquitin system [BR:myb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   MJD
    102247419 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 131 aa AA seqDB search
MSQGPGAPPRPPSVYHERQRLELCAIHALNNVLQQRLFSQEAADEICKRLAPDCRLNPHR
SFLGTGNYDVNVIMAALQGLGLAAVWWDRRRWDPKLGGLAFLGAVLAPGLCQVLVVVTKE
VEEKSSWLLTD
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagggcccaggagcgccgccacgaccaccctctgtgtaccacgagcggcagcgc
ctggagctgtgtgccatccacgccctcaacaacgtcctgcagcagcggctctttagccag
gaggctgccgatgagatctgcaagaggttggcccccgactgccggctgaacccccatcgc
agcttcctgggcaccggcaactatgacgtcaatgtgatcatggccgctctgcaggggctg
ggcctggccgcggtgtggtgggaccgaaggaggtgggacccgaagctcggtggcctggcc
ttcctgggggccgtgctggccccgggcctgtgccaggtgctggtggtggtgaccaaggag
gtggaggagaagagcagctggctgctgaccgactga

DBGET integrated database retrieval system