KEGG   Myotis brandtii (Brandt's bat): 102248077Help
Entry
102248077         CDS       T02920                                 

Gene name
UGT2A1
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102248077 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    102248077 (UGT2A1)
   00500 Starch and sucrose metabolism
    102248077 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102248077 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102248077 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    102248077 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102248077 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    102248077 (UGT2A1)
   00983 Drug metabolism - other enzymes
    102248077 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    102248077 (UGT2A1)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102248077 (UGT2A1)
Glycosyltransferases [BR:myb01003]
 Others
  Hydrophobic molecule
   102248077 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 241 aa AA seqDB search
MLEKSILLLSLQISLLGVTLGGNVLIWPMEGSHWLNVKIIIDELINKQHNVTVLVASGAL
YIKPTSNPSLTYEIYKVPFEKEKVEETIKKFILTWMGNKPTPSTIWRFYQEIGIAVEDFH
MLSREICDGVLKNQKLLEKLKKSKFDVLVSDPVFPCGDIVALKLGIPFMYSLRFSPASTV
EKHCGKIPYPPSYVPAVLSELTDQMSFTDRIRNFISYHLQDYMFDTLWKSWDSYYSEALG
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgttagaaaaatccattctgctgttgtctcttcagataagtctcctaggagtcactctt
ggtgggaatgttctgatttggccaatggaaggtagtcattggctaaatgttaagataatt
atagatgagctgattaacaaacagcataatgtgactgtcctagttgcttctggtgcactc
tacatcaagcccacctctaacccatctctgacatatgaaatatataaggtgccctttgag
aaagaaaaagtggaagaaacgatcaagaagtttattttgacatggatgggaaataaacca
actccttcaaccatttggagattctatcaggagattggcatagccgtcgaggacttccac
atgctgagtagagaaatctgtgatggtgttctcaaaaaccaaaagctgctggaaaagctg
aagaaaagcaaatttgacgtcctggtatcagatccagtatttccttgtggtgatatagta
gctttaaaacttggaattccatttatgtactccttaaggttttctccagcatcaacagtg
gaaaaacactgtgggaagataccataccctccttcctatgttcctgctgttttatcagaa
ctcaccgaccagatgtcttttactgacagaataagaaatttcatctcctaccatctacag
gactacatgtttgatactctttggaaatcgtgggattcctactatagtgaagctttgggt
aagtaa

DBGET integrated database retrieval system