KEGG   Myotis brandtii (Brandt's bat): 102248630Help
Entry
102248630         CDS       T02920                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 1
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    102248630
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     102248630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_8
Motif
Other DBs
NCBI-GeneID: 102248630
NCBI-ProteinID: XP_014388898
Position
Un
AA seq 234 aa AA seqDB search
MSFSAWSPGKHVYLSARIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKM
SQYLDSLEIGDVVEFRGPSGLLTYMGKGNFSIQPNQKSPPEPRVAKRLGMIAGGTGITPM
LQLIRAILKDPTDPTQCSLLFANQTEKDIILREDLEELQAQYPSRFQLWFTLDHPPADWA
YSQGFVTADMIQEHLPSPGDDVLLLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgtcattctctgcatggtccccaggcaaacatgtctacctctcagcccgaatcgatggc
agcctggtcatcaggccatacactcctgtcaccagtgatgaagaccaaggctatgtggat
cttgtcatcaaggtctacctgaaaggtgtgcaccccaagtttcctgagggagggaagatg
tctcagtacctggacagcctggagattggggatgtggtggaatttcgagggccgagtggg
ttgctcacttacatggggaaagggaattttagcattcagcccaaccagaagtctccacca
gagccccgagtggcgaagagactgggcatgatcgccggcgggacaggaatcaccccgatg
cttcagctgatccgggccatcctgaaagaccccacagatccaacccagtgctctttgctt
tttgccaaccagactgaaaaggacataatcttacgggaggacttggaggagctgcaggcc
caataccccagtcgctttcaactctggttcactctggatcatcccccagcagattgggcc
tacagccagggctttgtgactgcggacatgatccaggagcacctgccttccccgggggat
gatgtgctgctgcttctctgtgggcctcccccaatggtgcagctggcctgccaccccaac
ctggacaaactgggctactctcaaaagatgcgattcacctactga

DBGET integrated database retrieval system