KEGG   Myotis brandtii (Brandt's bat): 102248755Help
Entry
102248755         CDS       T02920                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
myb  Myotis brandtii (Brandt's bat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 727 aa AA seqDB search
MAAARKLSQVLDVLQVPSVQMFEIDLLFCRTATFRRQGEGIRVTEVDWQWPRNGAAHHTQ
EYPGPELVVRRGQMFTFMLELNCPLDSKDTLIFTVETGPQASEALGTKAVFPTSELEVGN
AWTAVRAAQKGNTVTIKVTSPPDAVIGRYRLSARLSSRRKHSDRKLGEFVLLFNPWCPED
DVFLASEEERQEYVLNDSGIIFRGVEKCIRAQGWNFGQFEEDILNICLSILDRSPSHQND
PATDVSCRHDPVYVTRIISAMVNSNNDRGVVQGQWQGKYGGGTSPLHWRGSVAILRKWFK
GRFKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNSAHDTDRNLSVDKYVDSFGRTLED
LTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQEESEGVFRCGPASVTAIREGDVH
LAHDGPFVFAEVNADYITWLWNEDDSRERVYSDTKKIGRCISTKAVGSDSRVDITGLYKY
PEGKGSTVASAASPMTRPLQRDNRGWRDQPATKPSIAGKFKVLEPPMLGHDLKLALSLTN
LTSRAQRVRVNVSCATILYTRRPVAEILRESQAVRLGPEEEKKIPITISYSQYKEDLTED
KKILLAAMCLVTKGEKLLVEKDITLEDFITIKVLGPAMVGVAVVVEVMVVNPLLEKVEDG
MLMVEGSGLLQGQLSIDVPSLEPQERALVQFNITPSKSGLRQLQVDFVSPQFSDIKGFVI
IHVATAK
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggctcgaaagctgagtcaggtcttggatgtgctgcaggtgccctctgtgcag
atgtttgagatagacctgctcttctgccggaccgcaaccttccggcggcagggcgaaggg
atcagagtcaccgaggtggactggcagtggccaaggaatggtgctgcccaccacacccag
gagtaccccggccccgagctggtggttcgcaggggccagatgttcaccttcatgctggag
ctgaactgccccctggacagcaaggacaccctcatcttcacggtggagacagggccccag
gcttctgaggctctcggcaccaaagccgtgttcccgacatcggagctggaggtgggaaat
gcctggacggcagtgagggcagctcagaaggggaacacagtgaccatcaaggtcaccagc
cctcccgatgccgtcattggccgctaccggctgagcgccaggctttcctctcgccgcaaa
cacagtgaccggaagctgggcgagtttgttctccttttcaacccctggtgcccagaggat
gatgtgtttctggcctcagaggaggagagacaggagtacgtgctcaatgacagcgggatc
atcttccgaggcgtggagaagtgcatccgagcccaaggctggaacttcgggcagtttgag
gaggacatcctgaacatttgcctctccatcctggaccgaagccccagtcaccaaaacgac
ccggccaccgatgtgtcctgccgccacgaccccgtctacgtcaccaggatcatcagcgcc
atggtgaacagcaacaacgaccggggcgtggttcaaggccagtggcagggcaagtacggc
ggcggcaccagcccactgcactggcgcggcagcgtggccatcctgcgcaagtggttcaag
ggcaggttcaagccagtcaaatacggccagtgttgggtcttcgctggagtcatgtgcaca
gtccttaggtgcttggggatcgcgacacgggttgtgtccaactttaactcggcccacgac
acagacagaaacctgagtgtggacaaatacgtggactccttcgggcggaccctggaggac
ctgacggaagacagcatgtggaatttccacgtctggaatgagagctggtttgcccggcag
gacctgggcccctcttacaatggctggcaggttctggatgccaccccccaggaggagagc
gaaggcgtgttccggtgcggcccggcctcagtcactgccatccgtgagggcgacgtgcac
ctggcccacgatggcccctttgtgtttgcggaggtcaatgcagactacatcacctggctc
tggaacgaggatgacagcagggaacgtgtgtattcagacacgaagaagattgggaggtgc
atcagcaccaaggctgtgggcagcgactcccgcgtggacatcacgggcctctacaagtac
ccagagggtaagggcagcacggtggcctctgcagcctccccgatgacccgaccgctgcag
agggacaaccgtgggtggcgggaccagcccgccaccaagcccagcatcgcgggcaagttc
aaggtgctggagccgcccatgctgggccacgacctaaagctggccctgagcctgaccaac
ctcacctcgcgggcccagcgggtccgagtcaacgtgagctgtgccaccatcctctacacc
cgcaggcccgtggccgagatcctgcgggagtcccaggcggtgcggctggggcccgaagaa
gagaaaaagatcccaatcacaatatcttactctcaatataaggaagacctgacagaggac
aagaagatcctgttggctgccatgtgccttgtcaccaaaggagagaagctcctggtagaa
aaggacattactctggaggacttcatcaccatcaaggtgctgggcccggccatggtgggg
gtagcagttgtagtggaagtgatggtggtcaaccccctcttggagaaagtagaagacggt
atgctgatggtggagggcagtggccttctccagggacagctcagcatcgatgtacccagc
ctggagccccaggagagggccttggtccagttcaacatcaccccctccaagagtggccta
aggcagctgcaggtggactttgtcagcccccaattctcagacatcaagggctttgttatc
atccacgtggccacagccaagtga

DBGET integrated database retrieval system