KEGG   Myotis brandtii (Brandt's bat): 102249393Help
Entry
102249393         CDS       T02920                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102249393
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102249393
Exosome [BR:myb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102249393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 659 aa AA seqDB search
MILPTRYKRFNQTLENIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTG
DFNDWNPFSYPYKKLEYGKWELYIPPKQDKSVIPHGSKLKVVIRSKSGEILYRISPWAKY
VAREGDNVNYDWIHWDPEHTYKFKHSRPKKPRGPRIYESHVGISSHEGKVASYKHFTCNI
LPRIKDLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGTPEELKELVDTAHSMGIIV
LLDMVHSHASKNSEDGLNMFDGTDSCYFHSGPRGNHDLWDSRLFAYSSWEVLRFLLSNIR
WWLEEYGFDGFRFDGITSMLYHHHGMGQGFSGDYHEYFGLQVDEDALIYLMLANHLVHML
YPDSITIAEDVSGMPALCCPISQGGCGFDYRLAMAIPDKWIKLLKEFKDEDWNMGDIVHT
LTNRRYLEKCIAYAESHDQALVGDKTLAFWLMDAEMYTNMSVLTPFTPVIDRGIQLHKMI
RLITHALGGEGYLNFMGNEFGHPEWLDFPRKGNNESYHYARRQFHLTDDDLLRYKFLNNF
DREMNQLEERCGWLSAPQAYVSEKHEANKVIAFERADLLFIFNFHPTKSYTDYRVGTKSL
GKFKIVLDSDEAEYGGHQRLDHNTDFFSEAFQHNGLPHSLLVYIPSRVALILQNVDLPN
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgattttacctaccaggtataagcggtttaaccagactttggagaacattggagagaat
gaaggtggcattgataagttctccagaggctatgaatcctttggggtccacagatgtgca
gatggcggcttatactgcaaggaatgggcccctggagcagaaggggtttttcttactgga
gatttcaatgattggaatccattttcatacccatataaaaaactggagtatgggaaatgg
gagctgtatataccaccaaagcaggataaatctgtaatacctcatggatccaaattaaag
gtagttattaggagtaaaagtggagagattttgtatcgtatttcaccatgggcgaagtat
gtggctcgtgaaggtgataatgtgaattatgattggatacattgggatcccgaacacaca
tataaatttaagcattccagaccaaagaagccaagaggtccaagaatttatgagtctcat
gtgggaatttcttcccatgaaggaaaagtagcttcttataaacattttacatgtaatata
ctaccaagaatcaaagaccttggatacaactgcattcaattgatggcaatcatggagcat
gcttattatgccagttttggttatcaaatcacaagcttctttgcagcttcaagccgttat
ggaactcctgaagagctaaaagaactggttgacacagctcactcgatgggtattatagtc
ctcttagatatggtacacagccatgcttcaaaaaattcagaggatggattgaatatgttt
gatgggacagattcctgttattttcattctggacctagagggaatcatgatctttgggat
agtcgattgtttgcctactccagctgggaagttttaagattccttctgtcaaatataaga
tggtggttggaagaatatggctttgatggttttcgttttgatggtattacatccatgcta
tatcatcaccatggaatgggtcaaggtttttcaggtgattatcatgaatattttggacta
caagtagatgaagatgccttgatttatctcatgctggcaaatcatttggttcacatgttg
tatccagattctattacaatagctgaggatgtatcaggaatgccagctctatgttgtcca
atttcccagggaggttgtggctttgactatcgattagccatggcaattccagataaatgg
attaagctacttaaagagtttaaagatgaagattggaatatgggcgacatagtgcacaca
ctcacaaacagacgctaccttgaaaagtgcattgcttatgcagagagccatgatcaggcg
cttgttggggataagacactggcattttggttgatggatgctgaaatgtataccaacatg
agtgttctgaccccttttactccagttattgatcgtggaatacagcttcataaaatgatt
cgactcattactcatgcccttggcggagaaggctatctcaactttatgggtaacgaattt
gggcatcctgaatggttagacttcccaagaaaaggaaataatgagagttaccattatgcc
agaaggcagtttcatttaactgatgatgaccttcttcgctataagtttttaaataacttt
gacagggagatgaatcaattggaagaaagatgtggttggctctcggcgccacaggcctat
gtgagtgaaaagcatgaagccaataaggtcatcgcttttgagagagcagatcttcttttt
attttcaacttccacccaaccaagagctacactgattaccgagttggaacgaaatctctg
ggaaaattcaaaattgtgcttgattcagatgaggcagaatatggaggacaccagagattg
gaccacaatacagatttcttttctgaagctttccaacataatgggcttccccattctctc
ttggtgtacattccaagccgagtggccctcatccttcagaatgtggatctgcccaactga

DBGET integrated database retrieval system