KEGG   Myotis brandtii (Brandt's bat): 102249629Help
Entry
102249629         CDS       T02920                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102249629 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 322 aa AA seqDB search
MMQAALLLTLSCLGLHAFWQAQAVPILLLGLAPDTFDDAYVGCAEEMEEKAALLLKEEMA
RHALLRESWEAAQEAWERKQRGLTLPPGFKSQHGIAIMVYTNSSNNLYWELNQAVQTGGV
SREYYMRHFPFKALHFYLTRALQLLQGSKGCSRGPGQVVFRGVGTLRFEPKRLGDSIRLG
QFASSSLDEAVALRFGNATFFSLRTCFGAPIEALSVFPKEREVLIPPHEVFLVTRFSQDG
ARSLVTLWSQNKTCSHFNCAYLGGEKRRGCMSIPSGQPDPLSNRAFSLLSWKTLHLAPIG
FQLSGAGPLKVQWLPLRSPANC
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggctgctctgctgctgaccctcagctgcctgggccttcacgccttctggcag
gcccaggctgttcccatcctgctcctgggcctggctccagacaccttcgatgatgcctat
gtgggctgcgcagaggagatggaggagaaggcagcccttctgctgaaggaggagatggcc
cgccatgcgctgctgcgggaatcctgggaggcagcccaggaggcctgggagcggaagcag
cgagggctcacactgccccctggcttcaaatcccagcatggaatcgccatcatggtctac
accaactcatctaacaacctgtactgggagctgaaccaggcggtgcagacaggcggtgtc
tcccgggagtactacatgaggcacttccccttcaaggccctgcatttctacctgacccgg
gccctgcagttgctacaggggagcaagggctgcagcaggggacccgggcaggtggtgttc
cgaggtgtaggcacccttcgctttgaacccaagaggttgggggactctatccgcttgggc
cagtttgcctccagctccctggatgaggcagtggccctcaggtttggtaatgccaccttc
ttctccctaaggacttgttttggggcccccatcgaggccctgtctgtttttcccaaggag
cgcgaggtgctgatccctccccacgaagtcttcttggttaccaggttctcccaagatgga
gcccggagcctagtgactctctggagccaaaataagacctgcagccactttaactgcgcc
tatctgggtggggagaagaggcggggctgtatgtctataccaagtgggcaaccagaccca
ctgtccaacagggccttctctctgctctcctggaagaccctacacttggcccccataggg
ttccagctctcgggagctgggcccttgaaagttcaatggctaccacttagaagtcctgcg
aactgttga

DBGET integrated database retrieval system