KEGG   Myotis brandtii (Brandt's bat): 102249629Help
Entry
102249629         CDS       T02920                                 

Gene name
ART5
Definition
(RefSeq) ADP-ribosyltransferase 5
  KO
K19977  
ADP-ribosyltransferase 5 [EC:2.4.2.31]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102249629 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 317 aa AA seqDB search
MMQAALLLTLSCLGLHAFWQAQAVPILLLGLAPDTFDDAYVGCAEEMEEKAALLLKEEMA
RHALLRESWEAAQEAWERKQRGLTLPPGFKSQHGIAIMVYTNSSNNLYWELNQAVQTGGV
SREYYMRHFPFKALHFYLTRALQLLQGSKGCSRGPGQVVFRGVGTLRFEPKRLGDSIRLG
QFASSSLDEAVALRFGNATFFSLRTCFGAPIEALSVFPKEREVLIPPHEVFLVTRFSQDG
ARSLVTLWSQNKTCSHFNCAYLGGEKRRGCMSIPTGGATRPTVQQGLLSALLEDPTLGPH
RVPALGSWALESSMATT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggctgctctgctgctgaccctcagctgcctgggccttcacgccttctggcag
gcccaggctgttcccatcctgctcctgggcctggctccagacaccttcgatgatgcctat
gtgggctgcgcagaggagatggaggagaaggcagcccttctgctgaaggaggagatggcc
cgccatgcgctgctgcgggaatcctgggaggcagcccaggaggcctgggagcggaagcag
cgagggctcacactgccccctggcttcaaatcccagcatggaatcgccatcatggtctac
accaactcatctaacaacctgtactgggagctgaaccaggcggtgcagacaggcggtgtc
tcccgggagtactacatgaggcacttccccttcaaggccctgcatttctacctgacccgg
gccctgcagttgctacaggggagcaagggctgcagcaggggacccgggcaggtggtgttc
cgaggtgtaggcacccttcgctttgaacccaagaggttgggggactctatccgcttgggc
cagtttgcctccagctccctggatgaggcagtggccctcaggtttggtaatgccaccttc
ttctccctaaggacttgttttggggcccccatcgaggccctgtctgtttttcccaaggag
cgcgaggtgctgatccctccccacgaagtcttcttggttaccaggttctcccaagatgga
gcccggagcctagtgactctctggagccaaaataagacctgcagccactttaactgcgcc
tatctgggtggggagaagaggcggggctgtatgtctataccaacagggggggcaaccaga
cccactgtccaacagggccttctctctgctctcctggaagaccctacacttggcccccat
agggttccagctctcgggagctgggcccttgaaagttcaatggctaccacttag

DBGET integrated database retrieval system