KEGG   Myotis brandtii (Brandt's bat): 102249978Help
Entry
102249978         CDS       T02920                                 

Gene name
TGM1
Definition
transglutaminase 1
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102249978 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 817 aa AA seqDB search
MMDGPRSDVGRWGVSPWQPPTSPSPEPEPEPDRRSRRGSRSFWARCCSCCSCRSGADDDW
GTEPHRDRGGGSSSGGRRPGSRGSDSRRPISRGSGVNAAGDGAIREGMLVVTGVDLMCSR
SDQNRREHHTDEFEYDELILRRGQPFHMVLYLSRPYESSDRVILELHIGNNPEVGKGTHV
IIPVGKGGSGGWKAQVTKSSGQNLNLRVHTSPNAIIGKFQFTVRTHSEAGEFLLPFDPHN
EIYILFNPWCPEDIVYVDREDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDAC
LYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEI
LLSYLRTGSSVPYGQCWVFAGVTTSVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENM
KPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSLQSIK
NGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIITKAIGSNMQEDVT
HLYKHPEGSAAERKAVETATAHGSKPNVYATRDSAEDVAIQVEAQDAVMGQDLTVSVVLT
NRSSSSSRTVKLHLYLSVTFYTGVTGSVFKENKKEVVLAPGASDRVTMPVAYQEYKPHLV
DQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAMVGQECEVQIVFKNPLPIT
LTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHG
VIQVDVAPASGSRGVFSDAGGSSRSGETIPMASRGGA
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgatggacggtcctcgatccgatgtgggccgctggggcgtgagcccctggcagcccccc
acctcaccctccccggagccggagccggagccggacagacggtcccgccgaggaagccgt
tccttctgggctcgatgctgtagctgctgctcctgccggagtggggcagatgatgactgg
gggactgagccccacagagacaggggtggagggtccagctctgggggacgaagacctggc
tcccggggctcagactcccgccggcctatctcacggggcagcggtgtgaacgcggccgga
gacggtgccatccgagagggcatgttggtggtgacgggtgtggatctcatgtgttcacgc
tcggaccagaaccgccgagagcaccacacggacgagttcgagtacgatgagctgatcctg
cgccgcgggcagcctttccacatggtgctctacctgtcgcggccctatgagtcctccgat
cgtgtcatcctggaactgcacatcggaaacaaccccgaggtgggcaagggcacccatgtg
atcatcccagtgggcaaggggggcagtggaggctggaaggcccaggtgaccaagtccagt
gggcagaatctgaacctacgggtccacacctcccccaacgccatcatcggcaagtttcag
ttcacagtccgcacacattcagaggctggcgagttcctgttgcccttcgacccccacaat
gagatctacatcctcttcaatccctggtgcccagaggacatcgtgtacgtggaccgtgag
gactggcggcaggagtacgtgcttaatgagtctgggagaatttactacgggactgaggcg
cagattggcgagcggacatggaactatggccagtttgaccatggggtgctggatgcctgc
ctgtacatcctggaccggcggggcatgccatatggaggccgtggggacccagtcagtgtc
tcccgggtcatctctgccatggtgaactccttagatgacaatggggtcctgattgggaac
tggtctggcgattactcccgaggcaccaacccgtcagcgtgggtgggcagcgtggagatc
ctcctcagctacctgcgcaccggctcttctgtcccctacggccaatgctgggtctttgcc
ggtgtgaccacctcagttttgcgctgcttgggcctggccactcgtaccgtcaccaacttc
aactcagcgcatgacacagacacgtccctcaccatggacatctactttgatgagaacatg
aagccgctcgagcatctgaaccatgattctgtctggaacttccacgtgtggaatgactgc
tggatgaagaggccggatctgccctcaggctttgatggttggcaggttgtggatgccaca
ccccaggagaccagcagtggcatcttctgctgtggcccttgctccctgcagtccatcaag
aatggcctggtctacatgaagtacgacacacccttcattttcgccgaggtgaacagtgac
aaggtttactggcagcgacaggacgatggcagcttcaaaattgtgtacgtggaggagaag
gccattggcacactcatcatcacaaaggccattggctccaacatgcaggaggatgtcacc
cacctttataagcacccagaaggctcagcagcagagcgtaaggcagtggagacagcaacc
gcccatggcagcaaacccaatgtgtacgccacccgggactcagctgaggacgtggcgata
caggtggaggcccaggacgcagtcatggggcaggatctgacggtcagcgtggtgctgacc
aatcgcagcagcagcagcagccgcaccgtgaagctgcacctctacctctcggtcaccttc
tacaccggtgtcaccgggtccgtcttcaaggagaacaagaaggaagtggtgctggctcca
ggggcctcggaccgtgtgaccatgccggtggcctaccaggaatacaagccccacctggtg
gaccagggggccatgctgctcaatgtctcgggccacgtcaaggagagcgggcaggtgctg
gccaagcagcacaccttccgtctgcgcaccccggacctctccctcacgttgttgggagca
gctatggttggccaggagtgcgaagtacagattgttttcaagaaccccctgcctatcacc
ctcaccaacgtagtcttccggctcgagggctccgggttacagagacccaagatcctcaac
gttggggacattgggggcaacgagacagtgacgctgcgccagacgttcgtgcctgtgcga
ccagggccccgccagctcatcgccagcttggacagcccacagctctcgcaggtgcacggt
gtcatccaggtggacgtggccccagcctccggcagccggggtgtcttctcagatgccgga
ggcagcagtcgctcaggagaaactattcctatggcttctcgaggtggggcttag

DBGET integrated database retrieval system