KEGG   Myotis brandtii (Brandt's bat): 102250549Help
Entry
102250549         CDS       T02920                                 

Gene name
UCHL3
Definition
(RefSeq) ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
  KO
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102250549 (UCHL3)
Peptidases [BR:myb01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   102250549 (UCHL3)
Ubiquitin system [BR:myb04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UCH
    102250549 (UCHL3)
  UBL-specific proteases (ULPs)
   102250549 (UCHL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 258 aa AA seqDB search
MDPELLSMVPRPVCAVLLLFPITEKYEVFRTEEEEKIKSQGQDVKSSVYFMKQTISNACG
TIGLIHAIANNKDKMHFESGSTLKKFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQ
TESSSPSSSQPHCSHCRTKASSLCHHASLPWVKRNHVDPAKATSPSLRLRRWRPFLRLPS
LGLHSVAPNIDEKVDLHFIALVHVDGHLYELDGRKPFPINHGETSDETLLEDAIEVCKKF
MERDPDELRFNAIALSAA
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgaactccttagcatggtaccaagaccagtgtgtgcagtattacttctcttc
cctattacagaaaagtatgaagtattcagaacagaagaggaggaaaaaataaaatctcag
ggacaagatgttaaatcgtcagtatatttcatgaagcaaacaatcagcaatgcctgtgga
acaattggactgatccatgctattgccaacaataaagacaagatgcattttgaatctgga
tcaaccttgaaaaaattcctagaggagtctgtgtcaatgagccctgaagaacgagccaga
tacctggagaactatgacgctattcgagttactcatgagaccagtgcccatgaaggtcag
actgagtcctcctcgccatcctcatcacagcctcattgtagccactgcagaacgaaggcc
tcatcattgtgtcaccatgcatccctgccctgggtcaaacgtaaccatgtagaccctgca
aaggctaccagtccatctctccgtcttcgtcgctggcgacccttcttacgcctaccatct
ttgggtctccattctgttgcaccaaatatagatgaaaaagtagatcttcattttattgca
ttagttcacgtagatgggcatctctatgaattagatggacggaaaccatttccaattaac
catggtgaaactagtgatgaaacgttattagaggatgccatagaagtttgcaagaagttt
atggaacgtgaccctgatgaattgagattcaatgcaattgctctttctgcagcatag

DBGET integrated database retrieval system