KEGG   Myotis brandtii (Brandt's bat): 102250898Help
Entry
102250898         CDS       T02920                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:myb00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 725 aa AA seqDB search
MLGFLQRPVVVTADVNLTVVALTAAGLLSRLWRLTYPRAVVFDEVYYGQYISFYMKRVFF
LDGSGPPFGHMLLALGGYLGGFDGNFVWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QILWELRFSHCAAMGAALLMLIENALITQARLMLLESLLIFFNLLAVLSYLKFSNSQKHR
PFSPSWWLWLTLTGVACSCAVGIKYMGIFTYLLVLGVAAVHTWHLIGDRALSNVCVLCHV
LARAVALVVVPAVTYLLFFYVHLTLLCRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
YGSQVTLKSASGKPVPCWLHSHPSTYPLSYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLEVSNPPRPVRHGDVVQLVHGMTSRLLNTHDVAAPLNPHAQEVSCYIDYNISMPAQS
LWRLDIVNRESDAEVWKTILSEVRLVHLNTSAILKLSGAHLPDWGFRQLEVVGEKLSRGY
HESAVWTVEEHRYGRSQEQKERELELHSPTHVDVSRNLSFMARFSELQWRMLTVRSDDSE
HKYSSTPLDWVTLDTNIAYWLHPRTSAQIHLLGNVVIWASAGLATALYALLFCWYLLRRR
RRVCELPEDSWLRWVLAGALCAGGWAANYLPFFLMEKTLFLYHYLPALTFQILLLPVVLQ
HIGEHLCRSQLHRSLFGALVVAWYSAACHVFNMLRPLTYGDKSLSPSDLQALRWKESWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgttggggtttctgcagcgccccgtcgtggtgaccgcggatgtcaacttgaccgtcgtg
gctctgacggcggcggggctgctgagcaggctgtggcgcctcacctacccccgggctgtg
gttttcgatgaagtctattacgggcagtacatctctttttacatgaagcgggtcttcttt
ttggatggcagcggaccgccctttggccacatgctgctggccttgggaggttatttggga
ggattcgacggcaactttgtgtggaacagaattggagcagaatacagcagcaacgtgccc
gtgtggtccttgcgcctgctgccggccctcgcaggggccctgtcggtgccgatggcctac
cagatcctgtgggagctccgattttctcactgcgccgccatgggagccgccctgctgatg
ctcatcgagaatgcgctgatcacgcaggccaggctgatgcttttggaatcgctgttaata
ttttttaatctactggccgtgctgtcctacctgaagttctccaactcccagaagcacagg
cccttctccccgagctggtggctgtggctgacgctgaccggagtggcctgctcctgcgct
gttggcatcaagtacatgggcattttcacttacttgctggtgctcggagtcgccgccgtc
cacacctggcacctgatcggagaccgggctctgtccaatgtctgtgtgctgtgccacgtg
ctggcccgcgctgtggctctggtggtcgtcccggccgtcacgtacctgctgttcttctac
gtccacttgacgctgctctgccgctccgggccccacgaccagatcatgtccagcgcgttc
caggccagcctggagggggggctggctcggatcacgcaaggccagcccctggaggtggcc
tacggctcacaggtcaccctgaagagcgcctcgggcaagcctgtgccctgctggctccac
tcccacccgagcacctacccgctgagctacgagaacggccggggcagctcccaccagcag
caggtgacctgttaccccttcaaagatgtcaacaactggtggattgtcaaggaccccggg
aggcaccagctggaggtgagcaacccgcccaggcccgtgcggcacggggacgtggtgcag
ctggtgcacggcatgaccagccgcctcctcaacacgcacgacgtggcagcccccctgaac
ccccacgcgcaggaggtgtcctgctacatcgactacaacatctccatgcccgcccagagc
ctctggaggctggacatcgtgaacagagagtcggacgccgaggtctggaagaccatcctg
tcggaggtgcgcctcgtgcacctgaacacgtcggccatcctgaagctgagcggggcccac
ctccccgactggggcttccggcagctggaggtggttggggagaagctgtcccggggctac
cacgagagcgccgtgtggaccgtggaggagcaccgctacggcaggagccaggagcagaag
gagagggagctggagctgcactcaccaactcacgtggacgtcagcaggaacctgagcttc
atggccagattctcggagctgcagtggaggatgctgacggtgaggagcgacgactcggag
cacaagtacagctccacgccgctggactgggtcaccctggacaccaacatcgcctactgg
ctgcaccccaggaccagtgctcagatccacctgctggggaacgtggtgatctgggcttcc
gccggcctcgccactgcgctgtacgccctgctcttctgctggtacctgctccgccgccgg
aggcgtgtctgtgagctccccgaggattcctggctgcgctgggtgctggccggggccctg
tgtgccggcggctgggcggcaaactacctcccgttcttcctgatggagaagacgctcttc
ctctaccactacctgcccgcactcaccttccagatccttctactgcccgtggtcttgcag
cacatcggcgagcacctgtgcaggtcccagctccacaggagcctgttcggcgccctggtg
gtggcgtggtactcggccgcctgccacgtgtttaacatgctgcgcccactgacctacggg
gacaagtcgctgtcacccagcgacctccaggcccttcgctggaaagagagctgggacatt
ctgatccgcaaacactag

DBGET integrated database retrieval system