KEGG   Myotis brandtii (Brandt's bat): 102251419Help
Entry
102251419         CDS       T02920                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2 (liver)
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102251419 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102251419 (GYS2)
   04152 AMPK signaling pathway
    102251419 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102251419 (GYS2)
   04922 Glucagon signaling pathway
    102251419 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    102251419 (GYS2)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102251419 (GYS2)
Glycosyltransferases [BR:myb01003]
 Polysaccharide
  Storage polysaccharide
   102251419 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKARTTADEWG
DNYFLIGPYFEQNMKTQVEKCEPANDAVRRAVDIMNKHGCQVHFGRWLIEGSPYVVLFDI
GFSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVITQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDEFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAMHEFQNLHAMY
KARIQEFVRGHFYGHLDFDLEKTLFFFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMMDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVESTSPPTTEGFKYPRPSSVPPSPTGSQVSSPQSSDVE
DEDEDERYNEEEEAERDRLNIKSPFSLGHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatccctatctgtgacatccctgagtgggcttccccagtgggaagtt
gaagaacttcccgtggaagatttgcttctctttgaagttgcttgggaagtgaccaataaa
gttggtggcatctatactgtgattcagacaaaggccagaacaacagcagatgaatgggga
gacaattactttctgattggtccatattttgagcaaaatatgaagactcaggtggaaaag
tgtgaacctgcaaatgatgctgttagaagagcagtggacataatgaataaacatggctgc
caagtacattttggaagatggctgatagaggggagtccttacgtggtgctctttgacata
gggttttcagcttggaatttggacaggtggaagggtgacctctgggaagcgtgcagtgtc
ggcattccttatcatgaccgagaagccaacgacatgttgatatttggatctttaacagcc
tggttcttaaaagaggtgacagaccatgcagacggtaaacacgtcattacccaattccac
gaatggcaggccggaaccggactgatcctttctcgagcccggaaacttcctatcgctaca
atttttaccactcacgccacactgcttgggaggtatctctgcgcagcaaacatcgatttc
tacaaccatcttgatgagtttgacatagacaaagaggctggggaaaggcagatctaccac
cggtactgcatggagcgggcctccgtccattgtgcgcacgtgttcaccacagtttctgaa
ataacagcaatagaggcagaacacatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaaattttcagcaatgcatgagtttcaaaatctacatgcaatgtac
aaggctaggatacaagaatttgttcggggtcatttttatggtcatctggactttgatctt
gaaaaaactttgttctttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagagtccttatccaggctcaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaaccctg
aaaggccaggcagtgcgaaagcagctatgggacattgcacattctgtgaaggaaaagttt
ggaaagaaactctatgatgccttattaagaggagaaattcctgatatgaacaatattttg
gatcgagatgatctaacaataatgaaaagagccatcttttcaactcagcgacagtctttg
cctccagtgaccactcacaacatgatggatgactccactgaccccatcctcagcaccatt
agacggattggacttttcaacagccgcacagacagagttaaggtgattttgcacccagag
ttcctatcctccaccagccccttgttacccatggattatgaagagttcgtccgaggttgt
caccttggagtatttccgtcatactatgagccgtggggttatactccagccgagtgcact
gtgatgggtatccccagtgtgacaaccaacctctccggctttggctgtttcatgcaggag
catgtggctgatcctactgcctacggtatttacattgttgacaggcggttccgctctccg
gatgattcttgcaatcagctgactaagtttctctatggattctgcaaacagtcacgtcgc
caaagaattatccagaggaaccgaactgagaggctctcagatcttctggactggagatac
ttaggcagatattaccagcatgccaggcacctgacattaagcagagcgtttccagataaa
ttccatgtggaatccacatcaccaccaacgacagagggatttaaataccccaggccttcc
tcagtaccaccttctcctaccgggtctcaggtgtccagtcctcagagcagtgatgtggaa
gacgaagatgaagacgagagatacaatgaggaagaggaggcggaaagggatcggttaaat
attaagtcaccattttctctgggccatgtccctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system