KEGG   Myotis brandtii (Brandt's bat): 102251419Help
Entry
102251419         CDS       T02920                                 

Gene name
GYS2
Definition
glycogen synthase 2 (liver)
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102251419 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    102251419 (GYS2)
   04152 AMPK signaling pathway
    102251419 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102251419 (GYS2)
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102251419 (GYS2)
Glycosyltransferases [BR:myb01003]
 Polysaccharide
  Storage polysaccharide
   102251419 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLSGLPQWEVEELPVEDLLLFEVAWEVTNKVGGIYTVIQTKARTTADEWG
DNYFLIGPYFEQNMKTQVEKCEPANDAVRRAVDIMNKHGCQVHFGRWLIEGSPYVVLFDI
GFSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVITQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDEFDIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAMHEFQNLHAMY
KARIQEFVRGHFYGHLDFDLEKTLFFFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDIAHSVKEKFGKKLYDALLRGEIPDMNNIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMMDDSTDPILSTIRRIGLFNSRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVESTSPPTTEGFKYPRPSSVPPSPTGSQVSSPQSSDVE
DEDEDERYNEEEEAERDRLNIKSPFSLGHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgctccgaggccgatccctatctgtgacatccctgagtgggcttccccagtgggaagtt
gaagaacttcccgtggaagatttgcttctctttgaagttgcttgggaagtgaccaataaa
gttggtggcatctatactgtgattcagacaaaggccagaacaacagcagatgaatgggga
gacaattactttctgattggtccatattttgagcaaaatatgaagactcaggtggaaaag
tgtgaacctgcaaatgatgctgttagaagagcagtggacataatgaataaacatggctgc
caagtacattttggaagatggctgatagaggggagtccttacgtggtgctctttgacata
gggttttcagcttggaatttggacaggtggaagggtgacctctgggaagcgtgcagtgtc
ggcattccttatcatgaccgagaagccaacgacatgttgatatttggatctttaacagcc
tggttcttaaaagaggtgacagaccatgcagacggtaaacacgtcattacccaattccac
gaatggcaggccggaaccggactgatcctttctcgagcccggaaacttcctatcgctaca
atttttaccactcacgccacactgcttgggaggtatctctgcgcagcaaacatcgatttc
tacaaccatcttgatgagtttgacatagacaaagaggctggggaaaggcagatctaccac
cggtactgcatggagcgggcctccgtccattgtgcgcacgtgttcaccacagtttctgaa
ataacagcaatagaggcagaacacatgctgaagagaaagcctgatgtagttactccaaat
ggcttgaatgttaagaaattttcagcaatgcatgagtttcaaaatctacatgcaatgtac
aaggctaggatacaagaatttgttcggggtcatttttatggtcatctggactttgatctt
gaaaaaactttgttctttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagagtccttatccaggctcaatttcctgctgaggatgcataaaagtgacgtc
acagtggtggtgtttttcattatgcctgccaagacaaacaatttcaatgtggaaaccctg
aaaggccaggcagtgcgaaagcagctatgggacattgcacattctgtgaaggaaaagttt
ggaaagaaactctatgatgccttattaagaggagaaattcctgatatgaacaatattttg
gatcgagatgatctaacaataatgaaaagagccatcttttcaactcagcgacagtctttg
cctccagtgaccactcacaacatgatggatgactccactgaccccatcctcagcaccatt
agacggattggacttttcaacagccgcacagacagagttaaggtgattttgcacccagag
ttcctatcctccaccagccccttgttacccatggattatgaagagttcgtccgaggttgt
caccttggagtatttccgtcatactatgagccgtggggttatactccagccgagtgcact
gtgatgggtatccccagtgtgacaaccaacctctccggctttggctgtttcatgcaggag
catgtggctgatcctactgcctacggtatttacattgttgacaggcggttccgctctccg
gatgattcttgcaatcagctgactaagtttctctatggattctgcaaacagtcacgtcgc
caaagaattatccagaggaaccgaactgagaggctctcagatcttctggactggagatac
ttaggcagatattaccagcatgccaggcacctgacattaagcagagcgtttccagataaa
ttccatgtggaatccacatcaccaccaacgacagagggatttaaataccccaggccttcc
tcagtaccaccttctcctaccgggtctcaggtgtccagtcctcagagcagtgatgtggaa
gacgaagatgaagacgagagatacaatgaggaagaggaggcggaaagggatcggttaaat
attaagtcaccattttctctgggccatgtccctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system