KEGG   Myotis brandtii (Brandt's bat): 102252898Help
Entry
102252898         CDS       T02920                                 

Definition
(RefSeq) T-cell ecto-ADP-ribosyltransferase 1
  KO
K19980  
ADP-ribosyltransferase 2 / NAD+ glycohydrolase [EC:2.4.2.31 3.2.2.5]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    102252898
Enzymes [BR:myb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     102252898
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.5  NAD+ glycohydrolase
     102252898
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:myb00537]
 Enzymes
  102252898
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 279 aa AA seqDB search
MTSLRAAAIHFLILTQWLTQQVTGWVQQANLCWLDMAENAFDDQYVGCTEEMEAKAPQLL
EEEFKVNRNLSAEWKKATKEWEKKKNKIDSSKRLNDSHGIALVAYTGNIGIEFNKAVRNF
GQNRGNFQFKAFHYYLTRALQLLKPTNCYTVYRGCKTKFGYSGKGNVRFGQFASSSLSKE
EAIKFTNNLKGTLFTIRTCSGVKIEMFSYYPSQKEVLIPGYEVYQQVNQTKNGVSLMNPK
RSKSNYNCFYINSSGMKESSAFILLLPGLLVLLLLPAEL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcttcgagccgcagccattcactttttgatcctaactcaatggctaacacaa
caggtgactggctgggtacaacaagctaatttatgttggctagacatggctgaaaatgca
tttgatgatcagtatgtgggctgtactgaagaaatggaggcaaaagcaccccagctgtta
gaagaagaatttaaagtgaatagaaatttaagtgcagaatggaaaaaggcaacaaaagaa
tgggagaaaaagaagaacaaaatagactcttcaaaacgactcaatgattcccatggaata
gctctagtggcctatactggaaatattggaatagaatttaacaaagctgtaagaaacttc
ggtcaaaatagaggtaactttcagttcaaagccttccattattatttgacaagagctctt
cagcttctcaagccaacgaattgttatacagtttatagaggctgtaagacaaagtttggt
tacagtgggaaaggaaatgtacgttttggccaatttgcctcatcatctctctctaaagaa
gaagctataaaatttactaacaatcttaagggaacactgtttaccatcagaacctgctca
ggtgttaaaattgaaatgttctcttactatccatcacaaaaggaagtgctaattccaggc
tatgaagtgtatcaacaagtcaaccaaactaaaaatggcgtttcacttatgaatcccaaa
agatctaagagtaactacaattgcttctatatcaacagctcaggaatgaaagaaagttct
gcattcattctgctgctgcctggcctcctggtcctgctgctcctccctgctgagctgtaa

DBGET integrated database retrieval system