KEGG   Myotis brandtii (Brandt's bat): 102254156Help
Entry
102254156         CDS       T02920                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Aldosterone synthesis and secretion
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102254156
 Organismal Systems
  Endocrine system
   04925 Aldosterone synthesis and secretion
    102254156
Enzymes [BR:myb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     102254156
Cytochrome P450 [BR:myb00199]
 Cytochrome P450, animal type
  CYP21 family
   102254156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 474 aa AA seqDB search
MGSPRPTGLLPSQECAILWAGRRPGRGKESRAPEQPGQQDVWWGPQSYKCQAGPAGPPAQ
LLLFSRLLWGQWQRRSLHLPPLAPGFLHLLQPNLPIHLLGLAQTLGPVYRLRLGLQDVVV
LNSKRTIEEAMVKKWVDFAGRPQIPSYQLVSRHNQDLSLGDYSPLWKAHKKLTRSALLLG
MRGPMEPLVERLTXXXXXXLRARAGAPVAIQEEFSLLTCSIICHLTFGDQEDAVVHTFHD
CVQDLMRTWDHWSVHILDIVPFLRFFPSPGLRRLKQAVESRDHLVEGQLSRHKESMVTGR
WRDAMDYMLQGVGKPPAEQGSGQLLEGHVHMSVVDLFIGGTSTTSTTLSWAVAFLLHHPE
VQKRLQEELDRELGPGAGCSGVPYKDRARLPLLNATIAEVLRLRPVVPLALPHRTTRPSS
ISGYDIPEGTVVIPNLQGAHLDETVWERPHEFWPGACGVGLVPVGGSVRAGARR
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgggctccccaaggccaacgggcctgctgccctcccaagaatgtgccatcctgtgggcg
ggccggaggccggggcgaggcaaggagtcaagggccccagagcagcccgggcagcaagat
gtatggtggggcccccagagctataagtgccaggccgggccggccgggcctccagcccag
ctgctccttttttcccgcctgctctggggccagtggcagcgcaggagcctccacctccca
cctcttgcccctggcttcctgcacctgctgcagcccaatctccccatccacctgctgggc
ctggctcagaccctcgggcctgtgtacaggctccgcctcgggctgcaagatgtggtggtg
ctgaactccaagaggaccattgaggaggccatggtcaagaagtgggtggactttgccggc
cgaccccagataccgtcctaccagctggtgtcccggcacaaccaggacctctccctgggg
gactactccccgctctggaaggcgcacaagaagctcacgcgctccgccctgctgctgggc
atgcgcggccccatggagcccctggtggagcggctgacnnnnnnnnnnnnnnnnnnnctg
cgggcccgggccggcgccccggtggccatccaggaggagttctcgctcctcacctgcagc
atcatctgtcacctcacctttggagaccaggaggatgccgtggtgcacacctttcacgac
tgtgtccaggacctgatgaggacctgggaccactggtccgtccacattttggacatcgtt
ccctttctcaggttcttccccagccccggcctccggaggctgaagcaggctgtggagagc
agggaccaccttgtggaggggcagctgagtaggcacaaggagagcatggtgacgggccgc
tggcgggacgccatggactacatgctgcagggggtggggaagccgccggccgagcagggc
tccgggcagctcctcgaggggcacgtgcacatgtccgtggtggaccttttcatcggcggc
acctcgaccacctcgaccaccctctcctgggctgtggcgtttttgcttcaccaccctgag
gtccagaagcgactgcaggaggagttggaccgtgagctgggtcccggggccgggtgctcc
ggagtcccctacaaggaccgcgcgcggctgcccctgctcaacgccaccatcgcggaggtg
ctgcgcctgcggcccgtcgtgcccctggccctgccacaccgcaccacgcggcccagcagc
atctccggctacgacatccccgagggcacggttgtcatccccaacctccaaggtgcccac
ctggacgagacggtctgggagcggccacacgagttctggcctggtgcgtgtggtgtgggg
ctggtgcccgtgggtgggagtgtgcgggccggtgcccgccgctga

DBGET integrated database retrieval system