KEGG   Myotis brandtii (Brandt's bat): 102254926Help
Entry
102254926         CDS       T02920                                 

Gene name
PADI1
Definition
(RefSeq) peptidyl arginine deiminase, type I
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     102254926 (PADI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 684 aa AA seqDB search
MRCPGADLGHRARGGREPGRRMASQRAVRLSLKKPTHAVCVVGVETFVDVRSDVPKGAET
FRVSGSSGVHIFIVYDPTRVAVPTDKAHWPLDTTVDLTVSVDTASKALNDLKVKVSYFGQ
SEDHALGRSELYLTGVDISLDVDTARKGKAKRSQGDKKTWRWGPAGYGAILLVNCDRDGL
GSRGLDLENSQLTSLEDLKDMSPMVLTCDGPDKLFDNHKLVLNVPFSDSKRVGVFCARGG
NSLSHYKQVLGPQHLSYEVERQPGEQKINFYVEGLTFPNADFSGLVSLSVSLVDMGTLPE
VPIFTDTVAFRMAPWIMTPNTQPPLELYVCSVIDAHGSNEKFLKDMSDLVSKANCKLIIC
PWIENRNDRWIQDEMEFGYVEAPHKSFPVVFDSPRDRGLKEFSYNRILGPDFGYVTQEIP
FAGASGLDSFGNLDVSPPVTVGGKEYPLGRILIGSNFPKTGGRRMAKVVRDFLKAQQVQA
PVELYSDWLSVGHVDEFLTFVPTSDQKGFRLLLASPSACLKLFQEKRAEGYGKAVQFDGL
EEKVKRSINELLADRSLQSDSLYVQKCIDWNREVLKRELGLTERDIVDIPQLFYLRGPHA
EAFFPDMVNMVVLGKYLGIPKPYGPIINGRCCLEEKVRSLLEPLGLHCIFIDDFLSYHKL
LGEIHCGTNVRRQPFSFKWWHMVP
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgaggtgcccgggagcggacctgggccaccgggcgcgaggaggtcgggagccagggcgc
aggatggcctcgcagagggctgtgcggctgagcctgaagaagcccacccatgcggtgtgt
gtggtgggagtcgagacctttgtggatgttcgcagcgatgtgcccaagggcgccgagacc
ttcagggtctctgggagctccggggtacatatcttcattgtctacgacccaacacgggtg
gcagtgcccacagacaaagcccactggcccctggacaccactgtggacctgactgtatcc
gtggacacagccagtaaggccttaaatgatctcaaggtgaaggtctcctacttcgggcag
agcgaggaccatgccctgggccgcagtgagctctacctcactggcgtcgacatctccctg
gatgttgacacagcccgcaagggcaaggcaaagaggagccaaggcgacaagaaaacctgg
cgctggggtcctgcgggctatggggctattctgctggtgaactgtgaccgggatggtctc
gggtccagggggctcgaccttgaaaacagccagctgacgtcactggaggacctgaaggac
atgtctcccatggtgctgacctgcgatggccctgacaagctcttcgacaaccacaagctg
gtcctgaatgtgccgttttctgattccaaaagagtgggcgtcttctgtgctcggggtggg
aattccctctcacactacaagcaggtgctggggccccagcatctgtcctacgaagtcgag
cggcagcccggggagcagaagatcaacttctatgtggaggggctcaccttccccaatgct
gatttctcggggctggtctctctcagcgtcagcctcgtggacatggggaccctgcccgag
gtgcccatcttcacagacactgtggccttccgcatggccccctggatcatgacccccaac
acccagccccccctggagctgtatgtgtgcagcgtgatagacgctcatggctcaaatgag
aaatttctgaaggacatgtctgacctggtgtcaaaagccaactgcaagctgatcatctgc
ccttggattgaaaatcggaatgatcgctggatccaggacgagatggaatttggctacgtg
gaggcaccccacaaatccttccccgtggtctttgactccccccgagacaggggcctgaag
gagttctcctataataggatcctgggccccgactttggatacgtaacccaggaaatccct
ttcgctggcgcctccggcctcgactccttcggcaacctggacgtcagcccaccggtgacc
gtgggcggcaaggagtaccccctgggccggatcctcatcggcagcaactttcctaagaca
ggtgggcggcgaatggccaaggtggtgcgtgacttcctgaaggcccagcaggtgcaggcg
cccgtggagctttactctgactggctctccgtgggccacgtggacgaattcctgaccttc
gtgcccacctccgaccaaaagggcttccggctgctcctggcgagccccagcgcttgcctt
aaactgttccaagagaagagagcggagggctacggcaaggcggtccagtttgatgggtta
gaggagaaggtgaagagaagcattaatgaattgctggctgacagaagcctccagagcgac
agtctctatgtgcagaaatgcatcgactggaaccgggaggtgctgaagcgggagctgggc
ctgacggagcgggacatcgtggacatcccgcagctcttctacctgaggggcccccacgca
gaagccttcttccccgacatggtcaacatggtggtcttaggcaagtacctgggcatcccc
aagccctacgggcccatcatcaacggccgctgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctccactgcatcttcatcgacgacttcctgtcctaccacaagctg
ctcggggagatccactgcgggaccaacgtgcgccggcagcccttctccttcaagtggtgg
cacatggtgccctga

DBGET integrated database retrieval system