KEGG   Myotis brandtii (Brandt's bat): 102255123Help
Entry
102255123         CDS       T02920                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
myb00250  Alanine, aspartate and glutamate metabolism
myb00410  beta-Alanine metabolism
myb00430  Taurine and hypotaurine metabolism
myb00650  Butanoate metabolism
myb01100  Metabolic pathways
myb04727  GABAergic synapse
myb04940  Type I diabetes mellitus
Module
myb_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102255123 (GAD1)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102255123 (GAD1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102255123 (GAD1)
   00430 Taurine and hypotaurine metabolism
    102255123 (GAD1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    102255123 (GAD1)
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    102255123 (GAD1)
Enzymes [BR:myb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102255123 (GAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 102255123
NCBI-ProteinID: XP_005857627
Position
Un
AA seq 594 aa AA seqDB search
MASSTPSSSATSSNAGADPNTANLRPTTYDTWCGVAHGCTKKLGLKICGFLQRTNSLEEK
SRLVSAFKDRQASKNLISCENSDRDGHFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDQPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIVGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPNLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCNERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
EICEKYNLWLHVDAAWGGGLLMSRKHRHKLSGIERASSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQI
NKCLELAEYLYAKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRSMPDSPERRERLHKVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcatcggctacctcctcgaacgctggagcggaccccaat
actgccaacctgcgtcccacaacgtatgacacctggtgtggcgtggcccatggatgcacc
aaaaaactggggctcaagatttgcggcttcttgcaaaggaccaacagcctggaagagaag
agccggctggtgagcgccttcaaggacaggcaggcctccaagaacctgatttcctgcgag
aacagcgacagggatggccacttcaggcgcacggagactgatttctccaacctgtttgct
cgagatctgcttccagctaagaacggggaggagcaaactgtgcaattcctactggaggtg
gtggacatactcctcaactatgtccgcaagacgtttgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctctgac
cagcctgagtccctggagcagattctggttgactgcagagacaccctgaagtatggggtc
cgcacaggtcatcctcgatttttcaatcagctctccactggactggatatcattggatta
gctggtgaatggctgacatcaactgccaataccaacatgtttacttatgaaattgctcca
gtgtttgtcctcatggagcaaataacgcttaagaagatgagagagatagttggatggtca
aataaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggcagcgcgctacaagtacttcccagaagttaagacaaagggcatggcggctgtgccc
aacctggtcctcttcacctcagaacatagtcactactccataaaaaaggctggggctgcg
cttggctttggaactgacaatgtgattttgataaagtgcaatgaaagggggaagataatt
cctgctgatttagaggcaaaaattcttgaagccaagcaaaagggatatgttcctctttac
gtcaatgcaactgctggcacgactgtttatggagcctttgatccgatacaggagattgca
gagatatgtgagaaatataacctttggctgcatgtcgacgctgcctggggcggtgggctg
ctcatgtccaggaagcaccgtcataaactcagtggcatagaaagggccagctcggtgacc
tggaaccctcacaagatgatgggcgtgctgctgcagtgctccgccatcctcgtcaaggag
aaggggatactccaaggatgcaaccagatgtgtgcaggctacctcttccagccagacaag
caatatgatgtctcctatgacactggggacaaggcaattcagtgtggccgtcacgtggac
attttcaagttctggctgatgtggaaagcaaagggaacagtgggatttgaaaatcagatc
aacaaatgcttggaactggctgaatacctctatgccaaaattaaaaacagagaagaattt
gagatggttttcaatggtgagcctgagcacacaaatgtctgtttctggtacatcccacaa
agcctccggagcatgccggacagccctgagcgacgggaaagactccacaaggtggctccc
aaaatcaaagccctgatgatggagtctggcacgaccatggttggctaccagcctcagggg
gacaaggccaacttcttccggatggtcatctcgaacccggccgccacccagtctgacatc
gacttcctcattgaggagatagaaagactgggccaggatctgtag

DBGET integrated database retrieval system