KEGG   Myotis brandtii (Brandt's bat): 102255223Help
Entry
102255223         CDS       T02920                                 

Gene name
PADI3
Definition
peptidyl arginine deiminase, type III
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 664 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMLEVYGTPGVDVYISPSMERGR
ERADTRRWRYNAGLEIIVVMNSPSNDVNDSHVQISYYSRHQPQPLAYTVLYLTCVDITLD
CDLDCEGRQNGSFVDKRQWVWGPDGYGAILLVNCDRDDLNCDDRDNCDQHVCCLQDLEDM
SVMVLRTQGPAALFDDHRLVLHTSSYDAKRARVFHVCGPEDSCEAYRHVLGRDKVSYEVP
RFHGDEERFFVEGLSFPDASFSGLVSFHVTLLDDSNEDFSESPIFTDTVVFRVAPWIMTP
STLPPLEVYVCQVRNNTQFVDAVAELAMKAGCKLTICPQAENRNDRWIQDEMELGYVQAP
HKTFPVVFDSPRNGELQDFPYKRILGPDFGYVTREPQDSSVCGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGSSGRRVTQVVRDFLHAQRVQPPVELFVDWLAVGHVDEFLSFVPA
PDGKGFRMLLASPGACFKLFQEKRKWGHGRALLFEGVVGNNQVNTISINQVLSNENLISY
NKFVQSCIDWNREVLKRELGLTERDIVDIPQLFKTERRKAVAFFPDLVNMLVLGKYLGIP
KPFGPIINGRCCLEEKVRSLLEPLGLHCTFIDDFTPYHLQHGEVHCGTNVRRQPFSFKWW
HMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcagaggatcgtgcgtgtgtccctggagcatcccaccagtgccgtgtgcgtg
gctggcgtggagaccctggtggacatttatgggtcagtaccggagggcacagagatgctc
gaggtctacgggacccccggtgtggacgtctacatctcgcccagcatggagaggggccgg
gagcgtgcggacaccaggcggtggcgctacaacgcagggctggagatcatcgtggtcatg
aactctcccagcaatgacgtcaacgacagtcatgttcagatttcctactactccagacat
cagccccagcccctggcatacaccgtgctctacctcacctgtgttgacatcaccctggat
tgcgacctggactgtgagggcaggcagaacggaagctttgtggacaagcgccaatgggtc
tgggggcccgatgggtatggggccatcctgctagtgaactgtgacagggacgatctgaac
tgtgatgaccgggacaactgtgaccagcacgtatgctgcctgcaagacctggaagacatg
tccgtcatggtcctgcggacccagggccccgctgccctcttcgatgaccacagactcgtc
ctccacacctccagctacgacgctaagcgggcacgggtcttccacgtctgtggtcccgag
gactcgtgcgaggcctacaggcatgtgctgggccgggacaaggtgtcctacgaggtgccc
cgcttccacggggacgaggagcgcttcttcgtggagggcctctccttccctgacgccagc
ttctcggggctcgtctccttccacgtcaccctgctggacgactccaatgaggatttctcc
gagtccccgatcttcactgacacggtcgtgttccgggtggccccctggatcatgacgccc
agcaccctgccgcccctcgaggtgtatgtgtgccaggtgaggaacaacacgcagttcgtg
gacgcagtggcggagctggccatgaaggccggctgcaagctgaccatctgcccgcaggcc
gagaaccgaaatgaccgctggatccaggacgagatggagctgggctacgtccaggcgccg
cacaagaccttcccggtggtcttcgactcccccaggaatggggagctgcaggacttccct
tacaagagaatcctgggtccagatttcggctatgtgactcgggagccgcaagacagctct
gtgtgtggcctggactccttcggaaacctggaggtcagccccccagtggtggccaacggg
aaagagtaccccctggggaggatcctcattgggggcaacctgcctgggtcaagtggccgc
agggtcacccaggtggtgcgggacttcctccatgcgcagagggtgcagccccccgtggag
ctctttgtggactggttggccgtgggccacgtggatgagtttctgagcttcgtcccggcc
cccgatgggaagggcttccggatgctcctggccagccccggcgcctgcttcaagctcttc
caggaaaagcggaagtggggccacggcagggccctgctgttcgaaggggttgttggtaac
aaccaggtcaacaccatctccatcaaccaggtcctctccaatgaaaacctcatcagctac
aataagttcgtgcagagctgcatcgactggaaccgggaggtgctgaagcgggagctgggc
ctgacggagcgggacatcgtggacatcccgcagctcttcaagaccgagaggagaaaggcg
gtggccttcttccctgacttggtgaacatgctggtgctgggcaagtacctgggcatcccc
aagcccttcgggcccatcatcaacggccgctgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctccactgcaccttcatcgacgacttcaccccgtaccaccttcag
cacggggaggtgcactgcgggaccaacgtgcgccgccagcccttctccttcaagtggtgg
cacatggtgccctga

DBGET integrated database retrieval system