KEGG   Myotis brandtii (Brandt's bat): 102255531Help
Entry
102255531         CDS       T02920                                 

Gene name
PADI6
Definition
peptidyl arginine deiminase, type VI
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 685 aa AA seqDB search
MAYQSIIHLSLDEPTHVVCVVGMEMCLELSGCAPNKCTSFTISSSPRVLVNLSHMVPAAT
NKEGASRLLLCESMDVLVMVKFPSSDISKEDKVSVSYYQPDGKVPVATAELFLTGIEVSL
DVDMYRSGQVQVASDKWAKKNWAWGPSGWGAILLVNCTPDGKAQDVDKTKVFLPEEINNL
SPMMLSVQGPSCFLKTYRLVLYTSKEEAKKARVYRPQGEYTFTFDLVLGPGCHTYTFPPL
ENSLKETFYVEATEFPSASFSGLISYSVALVEESENTVIPETLMHKDMVVFRVAPCIFTP
STQMPLEIYLCRELQVHGFVKTVIELSEKSNSQVASVYEDPNRLGRWLQDEMAFCYTQAP
YKTISLVFDTPRVSNLEDFPMKYSLSPGIGYVTRPTEDGKVITMDSIGNLMVSPPVKVKG
KEYPLGRILIGGSFYPSKEARDMRKDLRDFLYAQQVQAPVELYSDWLMTGHVDQFMCFVP
TQVKGEGDKGFRLLLASPRSCYQLFQEKQEAGYGDMALFEEVREDQLLSNGREATTINQL
LDDDDMRKQNDYVEKCINLNRDILKQELGLLERDIIHIPQLFCLEQLSNVPATEQTEKLY
ARPYFPNLLQMIVMGKHLGIPKPFGPQIKGTCCLEKRICQLLEPLGFKCTFINDFDCYMT
EIGDFCACANVRRVPFAYKWWKMMP
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccagagcatcatccacctgtccctggacgagcctacccatgtcgtttgtgtg
gtgggcatggagatgtgcttggaactcagtgggtgtgccccgaacaagtgcacgtccttc
accatcagcagctccccgagggtcttggtgaacctctcccatatggtccccgcggcaacc
aacaaggagggggccagcaggctgcttctgtgtgagtccatggatgtgctggtgatggtg
aagttccccagctctgacatcagcaaggaggacaaggtttcggtctcgtactatcagcca
gatgggaaggtcccggtggccaccgcggagctattcctcacgggcatcgaggtctccctg
gacgtggacatgtaccgcagcgggcaagtgcaggtggcgagtgacaaatgggctaagaaa
aactgggcctggggccccagtggctggggagccatcctgctggtgaactgcaccccggat
ggcaaggcccaggacgtagacaagaccaaggtgttcttgcctgaggaaataaacaatctg
tccccgatgatgctaagcgtccaggggcccagctgcttcttaaagacctaccggctggtt
ctctatacctccaaggaagaggccaagaaggcgagagtctatcggccccaaggtgagtac
accttcaccttcgacttggtgctggggcctggctgccacacctacacctttccccccctg
gagaactccctgaaggagaccttctatgtggaagccacggagttcccatccgccagcttc
tccggcctgatttcctactcggtcgccctggtggaagagtctgaaaacacggtaattcca
gagaccctgatgcacaaggacatggtcgtgttcagggtggctccttgcatcttcaccccg
agcacccagatgcctctagagatctacctgtgcagagagctgcaggtgcatggttttgtg
aagacggtgatcgagctcagcgagaagagtaacagccaggtggcgtctgtctacgaggac
cccaaccgcctgggcaggtggctccaggacgagatggccttctgctacacccaggcgccc
tacaagacgatctccttggtcttcgacaccccccgggtctccaacctcgaagatttcccc
atgaaatactccctgagcccggggattggctacgtgacccgacccaccgaggacggtaag
gtgatcactatggattccattgggaacctgatggtgtccccacccgtcaaggtcaaaggg
aaagagtatcctctcggcaggatcctcattggcggcagcttttaccccagcaaggaggcc
cgggacatgagaaaggacctccgggacttcctctacgcccagcaagtccaggccccggtg
gagctctactcagactggctgatgactggccacgtggaccagttcatgtgcttcgtcccc
acgcaggtcaagggtgagggcgacaagggcttccggctgctcctggccagcccccgctcc
tgctaccaactcttccaggagaaacaggaggcgggctatggggacatggccctgttcgag
gaagtgcgggaggaccagctcctttctaacgggagggaggccactaccatcaatcagctt
ctggatgatgacgacatgaggaagcagaacgactacgtggagaagtgcattaacctgaac
cgagacatcctgaagcaggagctgggcctgctggagagggacatcatccacatcccacag
ctcttctgcttggagcagctgagcaatgtgcccgccacggagcagacagagaaactctac
gccaggccctacttccccaacctgctgcagatgattgtgatgggcaagcacctgggcatc
cccaagccttttgggccccagatcaagggcacctgctgcctggaaaagaggatctgccag
ttgctggagcccctgggcttcaaatgcaccttcatcaacgactttgactgctacatgact
gagatcggagacttctgtgcctgcgccaacgtccgccgcgtgccctttgcctataaatgg
tggaagatgatgccttag

DBGET integrated database retrieval system