KEGG   Myotis brandtii (Brandt's bat): 102255618Help
Entry
102255618         CDS       T02920                                 

Definition
ribokinase-like
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:myb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    102255618
Enzymes [BR:myb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     102255618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 297 aa AA seqDB search
MCPADVTERKGVASSCVTSTSWAHEEPFKRGTLPSPKLYDPLITRERGRSQVNRGPGRYR
RGERVTPGLEDAVLEGTGVTGTSRASLELGLLYRKGKRALGTALGTTCATRGPTSPHQPQ
SSLTPRLPKTGETIHGHKFFIGFGGKGANQCVQAARLGAKTAMVCKVGKDSFGNDYIENF
KQNDISTEFTYQTKDAATGTASIIVNKEGQNIIVIVAGANLLLNTEDLREAANAISSAKV
MICQLEVTPAISLEALTMAHSSGVKTLFNPAPATADLDPRFYTLSDVFCCNETENIK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtgccctgctgacgtcacggaacggaaaggggtagcgtccagctgcgtcacgtccacg
tcatgggcgcacgaggagccatttaaaaggggcactctcccttctcccaaattgtatgac
cccctcatcacgagggaaagagggagaagtcaggttaatcggggaccggggcggtataga
cgaggagaaagagtaacgcctggcctggaggatgccgttcttgaggggaccggcgtgacg
gggacgagcagggcatctttggagctgggccttctctacaggaaggggaagcgagctctg
ggcacggccctcggcaccacctgtgcgactcggggtccaacctccccacaccagccccag
tctagtcttactcctcgtttgccaaaaaccggagaaaccatccatggacataagtttttt
attggctttggagggaaaggtgccaatcagtgtgtccaagctgctaggcttggagcaaag
acggccatggtgtgcaaggttggcaaagattcttttggcaatgattacatagaaaacttt
aaacagaatgatatttctacagaatttacatatcaaactaaagatgctgctacaggaact
gcttctataattgtcaataaagaaggccagaatatcatcgtgatagtggctggagcaaat
ttacttttgaatactgaagacctgagagaagcagccaatgccattagcagcgccaaagta
atgatctgccagctagaagtaactccagcaatttctttggaagccctaacaatggcccac
agcagtggagtgaaaacattgttcaacccagctcccgccactgctgacctggacccccgg
ttctacaccctctcagatgtgttctgctgcaatgaaactgagaacataaagtaa

DBGET integrated database retrieval system