KEGG   Myotis brandtii (Brandt's bat): 102255672Help
Entry
102255672         CDS       T02920                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     102255672 (JOSD1)
Peptidases [BR:myb01002]
 Cysteine Peptidases
  Family C86
   102255672 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 202 aa AA seqDB search
MSCVPWRGDKAKSESPEPPQAAPPRIYHEKQRRELCALHALNNVFQDGGAFNRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSAIALTNVMGFIM
NLPSSLSWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWIGGESELRKFLKHHLRGK
NCELLLVVPEEVEAHQSWRADM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagctgcgtgccatggaggggagacaaggccaagtcggagtccccggagccgccccag
gccgcgcccccccggatctaccacgagaagcagcgccgggagctctgcgccctgcacgcc
ctcaacaacgtcttccaggacggcggcgcgttcaaccgggagacgctgcaggagattttc
cagaggttgtctccaaacaccatggtgaccccccacaagaagagcatgctgggaaatggg
aactacgatgtgaacgtcattatggcagcacttcagaccaaaggctatgaagctgtttgg
tgggacaagcgcagggatgtcagtgccattgctctcactaatgtcatgggcttcatcatg
aatctgccctccagcctgagctggggtccactgaagttacctctcaaaaggcagcactgg
atctgtgttcgagaggtgggcggtgcctactacaaccttgactccaagctgaagatgccc
gaatggattggaggcgagagcgagctcaggaaatttctaaaacatcatttgcgaggaaag
aactgtgaactcctgctggtggtaccagaagaggtggaggcccatcagagttggagggct
gatatgtaa

DBGET integrated database retrieval system