KEGG   Myotis brandtii (Brandt's bat): 102255887Help
Entry
102255887         CDS       T02920                                 

Definition
ribonuclease pancreatic-like
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
myb  Myotis brandtii (Brandt's bat)
Brite
Enzymes [BR:myb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.5  pancreatic ribonuclease
     102255887
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 155 aa AA seqDB search
MAQEKSLILFPLLVLVLLVLGWVQPSLGKESRAMKFQRQHMDPDGPNNNSNYCNQMMRRR
HMTEGRCKPVNTFVHEPLVDVQAVCLQGNITCKNGQPNCHKSSSSMKITDCRVTSGSKYP
NCDYRTSQKEKHIIVACEGNPYVPVHFDASVEVST
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atggctcaggagaagtccctcatcctgttcccactgctagtcctggtgctgttagtgctg
gggtgggtccagccttccctgggcaaggaatcacgggccatgaagttccagcggcaacac
atggacccagacggccccaacaacaactccaactactgcaaccaaatgatgaggcgccgg
catatgacagagggacggtgcaagccagtgaacaccttcgtgcacgagcctctggtagat
gtccaggccgtttgcctccagggaaacatcacctgcaagaatgggcagcccaactgccac
aagagcagctccagcatgaagatcacggactgtcgtgtgacaagcggctccaagtacccc
aactgtgactaccgaaccagccagaaagagaagcacatcatcgtggcctgtgagggaaac
ccatacgtacccgtccactttgatgcttcagtagaggtctccacctga

DBGET integrated database retrieval system