KEGG   Myotis brandtii (Brandt's bat): 102256768Help
Entry
102256768         CDS       T02920                                 

Gene name
KAT2B
Definition
(RefSeq) K(lysine) acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
myb  Myotis brandtii (Brandt's bat)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:myb00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102256768 (KAT2B)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    102256768 (KAT2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    102256768 (KAT2B)
  Infectious diseases
   05166 HTLV-I infection
    102256768 (KAT2B)
Enzymes [BR:myb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102256768 (KAT2B)
Transcription machinery [BR:myb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102256768 (KAT2B)
Chromosome [BR:myb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102256768 (KAT2B)
   HAT complexes
    PCAF complex
     102256768 (KAT2B)
    STAGA complex
     102256768 (KAT2B)
    TFTC complex
     102256768 (KAT2B)
    SAGA complex
     102256768 (KAT2B)
    SLIK complex
     102256768 (KAT2B)
    ADA-HAT complex
     102256768 (KAT2B)
    HAT-A2 complex
     102256768 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 774 aa AA seqDB search
MIGISEEGMQKKEKVGGVLLRKVKGQELVMKDISLIKSKVKNNAEESCKCIGWKNPDRSP
TPPRADLQQKIVSLTDSCRSCSHALAAHVSHLEDVSEEEMNRLLGIVLDVEYLFTCVHKE
EDADTKQVYFYLFKLLRKTILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPS
KERQTIVELAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSL
PRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVY
SQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYTSNSSSLEQPNGGSSSPSGKGS
SGLEANPGEKRKMNDSHVLEEAKKPRVMGDIPMELIHEVMSTITDPAVMVGPENNLLSAH
SARDEAARMEERRGVIEFHVVGNSLNQKPNKKILMWLVGLQNVFSHQLPRMPKEYITRLV
FDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEFHI
KHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPQIPYTE
FSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKQSGKEK
SKEPKDSDQLYSTLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLK
NRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgattggcatttctgaagaagggatgcaaaaaaaagaaaaagtggggggcgtgctccta
agaaaggtgaagggccaggagttggttatgaaggacattagcctaatcaagagcaaggtc
aagaacaacgcggaggagtcttgtaaatgcattggctggaaaaaccccgaccgttctccc
actccccccagagccgatctgcagcagaagattgtgagcctaacagactcctgccggagt
tgtagccatgccctagctgctcatgtttcccacttggaggatgtgtcagaggaagaaatg
aacaggctcctgggaatcgtgttggatgtggaatatctctttacctgtgtccataaggaa
gaggatgcagacaccaaacaagtttatttctacctattcaagctcttgagaaagactatt
ttacaaagaggaaaacctgtggttgaaggctctttggagaagaaacccccatttgaaaaa
cctagtattgaacagggtgtgaataacttcgtacagtacaaattcagtcacctgccatcc
aaagaaaggcagacaatagtggagttggcaaaaatgttcctaaaccgcatcaactattgg
catctggaggcaccatctcaacgaagactgcgatctcccaatgatgatatttctggatac
aaagagaactacacaaggtggctgtgttattgcaacgtaccacagttctgtgacagtcta
cctcgatatgaaaccacccaggtgtttgggagaacactgcttcgctcagtcttcaccgtt
atgagacgacagctcctggaacaagcaagacaggaaaaagacaaattgccacttgagaaa
cgaactctaatcctcacccatttcccaaagtttctgtccatgttagaagaagaagtttac
agtcaaaactctcctatctgggatcaggactttctgtcggcctcttccagaaccagccag
ctagggatccaaacagtcatcaacccacctcctgtggctgggacgatttcatacacttca
aactcatcttcccttgagcagccgaatggtgggagcagcagtccttccggcaaaggctca
tctgggcttgaggcaaacccaggagaaaagaggaaaatgaatgactctcatgttttggag
gaggccaagaaaccccgagttatgggggatattccaatggaattaatccacgaggtcatg
tctaccatcacggaccctgcagtaatggttggaccagagaacaatcttctgtcagcacat
tcggccagggatgaggcagccaggatggaagagcgcaggggtgtgattgagtttcacgtg
gtcggcaattccctgaaccagaaacccaacaagaagatcctgatgtggctggtgggtcta
cagaacgtgttctcccatcagctgccccgaatgcccaaagagtacatcacacggcttgtc
tttgacccgaaacacaaaacccttgctttaattaaagatggccgtgttattggtggtatc
tgtttccgtatgtttccatcccaaggattcacggagattgttttctgtgctgtaacgtca
aatgagcaagtcaagggctatggaacacacctgatgaatcatttgaaagaatttcatata
aaacatgacatcctgaacttcctcacatatgcagatgaatatgcaatcggatatttcaag
aaacagggtttctccaaagaaattaaaatacctaaaaccaaatatgttggctacatcaag
gactatgaaggagccactttaatgggatgtgagctaaatccacagatcccatacacagaa
ttttctgtcatcattaagaagcagaaggagatcattaaaaagctgatagaaagaaaacaa
gcccagattcgaaaagtctaccctggactttcatgttttaaagatggagttcgacagatc
ccgatagaaagcattcctggaattagagagacaggctggaaacagagtggaaaagagaaa
agtaaagagcccaaagactctgaccagctctacagcacgctcaagagcatcctccagcag
gtgaagagccatcaaagcgcttggcccttcatggaacctgtgaagagaacagaagctccg
ggatattatgaagttataaggttccccatggatctgaaaaccatgagtgaacgcctcaag
aataggtactatgtgtctaagaaattattcatggcagacttacagcgagtcttcaccaac
tgcaaagagtacaacccccctgagagtgaatactacaaatgtgccaatatcctggagaaa
ttcttcttcagtaagattaaggaagctggattaattgacaagtga

DBGET integrated database retrieval system